Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ARF5Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ARF5 Polyclonal Antibody | anti-ARF5 antibody

ARF5 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ARF5; Polyclonal Antibody; ARF5 Antibody - middle region; anti-ARF5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSEL
Sequence Length
180
Applicable Applications for anti-ARF5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARF5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARF5Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARF5Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ARF5 antibody
This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization.
Product Categories/Family for anti-ARF5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
381
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
ADP-ribosylation factor 5
NCBI Official Synonym Full Names
ADP ribosylation factor 5
NCBI Official Symbol
ARF5
NCBI Protein Information
ADP-ribosylation factor 5
UniProt Protein Name
ADP-ribosylation factor 5
Protein Family
UniProt Gene Name
ARF5
UniProt Entry Name
ARF5_HUMAN

NCBI Description

This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010]

Uniprot Description

ARF5: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric, ARF; G protein; G protein, monomeric; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: vesicle-mediated transport; protein transport; metabolic process; small GTPase mediated signal transduction

Research Articles on ARF5

Similar Products

Product Notes

The ARF5 arf5 (Catalog #AAA3222473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARF5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARF5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARF5 arf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVVDSNDRER VQESADELQK MLQEDELRDA VLLVFANKQD MPNAMPVSEL. It is sometimes possible for the material contained within the vial of "ARF5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.