Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ARF3Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ARF3 Polyclonal Antibody | anti-ARF3 antibody

ARF3 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ARF3; Polyclonal Antibody; ARF3 Antibody - middle region; anti-ARF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFA
Sequence Length
181
Applicable Applications for anti-ARF3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ARF3Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARF3Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ARF3 antibody
ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns.
Product Categories/Family for anti-ARF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
377
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa
NCBI Official Full Name
ADP-ribosylation factor 3
NCBI Official Synonym Full Names
ADP ribosylation factor 3
NCBI Official Symbol
ARF3
NCBI Protein Information
ADP-ribosylation factor 3
UniProt Protein Name
ADP-ribosylation factor 1
Protein Family
UniProt Gene Name
ARF1
UniProt Entry Name
ARF1_HUMAN

NCBI Description

ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. [provided by RefSeq, Jul 2008]

Uniprot Description

ARF1: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking among different compartments. Modulates vesicle budding and uncoating within the Golgi complex. Deactivation induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, suggesting a crucial role in protein trafficking. In its GTP-bound form, its triggers the association with coat proteins with the Golgi membrane. The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein; G protein, monomeric, ARF; Motility/polarity/chemotaxis; G protein, monomeric

Chromosomal Location of Human Ortholog: 1q42

Cellular Component: Golgi membrane; postsynaptic membrane; neuron projection; sarcomere; focal adhesion; perinuclear region of cytoplasm; postsynaptic density; plasma membrane; cytosol

Molecular Function: GTPase activity; protein binding; GTP binding; receptor signaling protein activity

Biological Process: protein transport; cellular copper ion homeostasis; COPI coating of Golgi vesicle; viral reproduction; regulation of receptor internalization; small GTPase mediated signal transduction; phospholipid metabolic process; phosphatidylinositol biosynthetic process; retrograde vesicle-mediated transport, Golgi to ER; antigen processing and presentation of exogenous peptide antigen via MHC class II; post-Golgi vesicle-mediated transport; regulation of defense response to virus by virus

Research Articles on ARF3

Similar Products

Product Notes

The ARF3 arf1 (Catalog #AAA3222456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARF3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARF3 arf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLWRHYFQNT QGLIFVVDSN DRERVNEARE ELMRMLAEDE LRDAVLLVFA. It is sometimes possible for the material contained within the vial of "ARF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.