Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AQP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Rabbit AQP10 Polyclonal Antibody | anti-AQP10 antibody

AQP10 antibody - middle region

Gene Names
AQP10; AQPA_HUMAN
Reactivity
Human, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AQP10; Polyclonal Antibody; AQP10 antibody - middle region; anti-AQP10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
Sequence Length
301
Applicable Applications for anti-AQP10 antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 82%; Yeast: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AQP10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AQP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-AQP10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human kidney)
Related Product Information for anti-AQP10 antibody
This is a rabbit polyclonal antibody against AQP10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea. This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
Product Categories/Family for anti-AQP10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
aquaporin-10
NCBI Official Synonym Full Names
aquaporin 10
NCBI Official Symbol
AQP10
NCBI Official Synonym Symbols
AQPA_HUMAN
NCBI Protein Information
aquaporin-10
UniProt Protein Name
Aquaporin-10
Protein Family
UniProt Gene Name
AQP10
UniProt Synonym Gene Names
AQP-10
UniProt Entry Name
AQP10_HUMAN

NCBI Description

This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea. [provided by RefSeq, Jul 2008]

Uniprot Description

AQP10: Water channel required to promote glycerol permeability and water transport across cell membranes. May contribute to water transport in the upper portion of small intestine. Isoform 2 is not permeable to urea and glycerol. Belongs to the MIP/aquaporin (TC 1.A.8) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter, aquaporin family; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: urea transmembrane transporter activity; water channel activity; glycerol channel activity

Biological Process: glycerol transport; cellular water homeostasis; response to toxin; water transport; transmembrane transport

Research Articles on AQP10

Similar Products

Product Notes

The AQP10 aqp10 (Catalog #AAA3209858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AQP10 antibody - middle region reacts with Human, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's AQP10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AQP10 aqp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGATVGTATY QLLVALHHPE GPEPAQDLVS AQHKASELET PASAQMLECK. It is sometimes possible for the material contained within the vial of "AQP10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.