Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AQP7 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

Rabbit anti-Human AQP7 Polyclonal Antibody | anti-AQP7 antibody

AQP7 antibody - C-terminal region

Gene Names
AQP7; AQP7L; AQPap; GLYCQTL
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AQP7; Polyclonal Antibody; AQP7 antibody - C-terminal region; anti-AQP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA
Sequence Length
342
Applicable Applications for anti-AQP7 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AQP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AQP7 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-AQP7 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Related Product Information for anti-AQP7 antibody
This is a rabbit polyclonal antibody against AQP7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.
Product Categories/Family for anti-AQP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
364
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
aquaporin-7 isoform 1
NCBI Official Synonym Full Names
aquaporin 7
NCBI Official Symbol
AQP7
NCBI Official Synonym Symbols
AQP7L; AQPap; GLYCQTL
NCBI Protein Information
aquaporin-7
UniProt Protein Name
Aquaporin-7
Protein Family
UniProt Gene Name
AQP7
UniProt Synonym Gene Names
AQP7L; AQP9; AQP-7; AQPap
UniProt Entry Name
AQP7_HUMAN

NCBI Description

This gene encodes a member of the aquaporin family of water-selective membrane channels. The encoded protein localizes to the plasma membrane and allows movement of water, glycerol and urea across cell membranes. This gene is highly expressed in the adipose tissue where the encoded protein facilitates efflux of glycerol. In the proximal straight tubules of kidney, the encoded protein is localized to the apical membrane and prevents excretion of glycerol into urine. The encoded protein is present in spermatids, as well as in the testicular and epididymal spermatozoa suggesting an important role in late spermatogenesis. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene is located adjacent to a related aquaporin gene on chromosome 9. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Dec 2015]

Uniprot Description

AQP7: Forms a channel for water and glycerol. Belongs to the MIP/aquaporin (TC 1.A.8) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, aquaporin family

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane; intercellular junction

Molecular Function: urea transmembrane transporter activity; water channel activity; glycerol channel activity

Biological Process: glycerol transport; generation of precursor metabolites and energy; cellular water homeostasis; water transport; excretion; transmembrane transport

Disease: Glycerol Quantitative Trait Locus

Research Articles on AQP7

Similar Products

Product Notes

The AQP7 aqp7 (Catalog #AAA3201178) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AQP7 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AQP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AQP7 aqp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSVAYEDHGI TVLPKMGSHE PTISPLTPVS VSPANRSSVH PAPPLHESMA. It is sometimes possible for the material contained within the vial of "AQP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.