Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human AdrenalAnti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit anti-Human APOE Polyclonal Antibody | anti-APOE antibody

APOE antibody - N-terminal region

Gene Names
APOE; AD2; LPG; APO-E; ApoE4; LDLCQ5
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
APOE; Polyclonal Antibody; APOE antibody - N-terminal region; anti-APOE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
Sequence Length
317
Applicable Applications for anti-APOE antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human AdrenalAnti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC) (Sample Type: Human AdrenalAnti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC)

(Sample Type: Human kidney.Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC) (Sample Type: Human kidney.Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC)

(Sample Type: Rat BrainAPOE antibody - N-terminal region validated by WB using Rat brain lysate at 1: 500)

Immunohistochemistry (IHC) (Sample Type: Rat BrainAPOE antibody - N-terminal region validated by WB using Rat brain lysate at 1: 500)

Immunohistochemistry (IHC)

(Sample Type: Human Liver TissueAPOE antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and membrane of hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Sample Type: Human Liver TissueAPOE antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and membrane of hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Sample Type: Mouse brainAPOE antibody - N-terminal region validated by WB using brain lysate at 1: 1,000.)

Western Blot (WB) (Sample Type: Mouse brainAPOE antibody - N-terminal region validated by WB using brain lysate at 1: 1,000.)

Western Blot (WB)

(Sample Type: Human Fetal liverAPOE antibody - N-terminal region validated by WB using Fetal liver cell lysate at 1ug/ml.)

Western Blot (WB) (Sample Type: Human Fetal liverAPOE antibody - N-terminal region validated by WB using Fetal liver cell lysate at 1ug/ml.)

Western Blot (WB)

(Host: RabbitTarget Name: APOESample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APOESample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: APOESample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APOESample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Human Brain and cell HomogenatesDilution : 1:1000/ 1:2000)

Western Blot (WB) (Human Brain and cell HomogenatesDilution : 1:1000/ 1:2000)
Related Product Information for anti-APOE antibody
This is a rabbit polyclonal antibody against APOE. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
348
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
apolipoprotein E isoform b
NCBI Official Synonym Full Names
apolipoprotein E
NCBI Official Symbol
APOE
NCBI Official Synonym Symbols
AD2; LPG; APO-E; ApoE4; LDLCQ5
NCBI Protein Information
apolipoprotein E
UniProt Protein Name
Apolipoprotein E
Protein Family
UniProt Gene Name
APOE
UniProt Synonym Gene Names
Apo-E
UniProt Entry Name
APOE_HUMAN

NCBI Description

The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. [provided by RefSeq, Jun 2016]

Uniprot Description

APOE: Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. Defects in APOE are a cause of hyperlipoproteinemia type 3 (HLPP3); also known as familial dysbetalipoproteinemia. Individuals with HLPP3 are clinically characterized by xanthomas, yellowish lipid deposits in the palmar crease, or less specific on tendons and on elbows. The disorder rarely manifests before the third decade in men. In women, it is usually expressed only after the menopause. The vast majority of the patients are homozygous for APOE*2 alleles. More severe cases of HLPP3 have also been observed in individuals heterozygous for rare APOE variants. The influence of APOE on lipid levels is often suggested to have major implications for the risk of coronary artery disease (CAD). Individuals carrying the common APOE*4 variant are at higher risk of CAD. Genetic variations in APOE are associated with Alzheimer disease type 2 (AD2). It is a late-onset neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death. The APOE*4 allele is genetically associated with the common late onset familial and sporadic forms of Alzheimer disease. Risk for AD increased from 20% to 90% and mean age at onset decreased from 84 to 68 years with increasing number of APOE*4 alleles in 42 families with late onset AD. Thus APOE*4 gene dose is a major risk factor for late onset AD and, in these families, homozygosity for APOE*4 was virtually sufficient to cause AD by age 80. The mechanism by which APOE*4 participates in pathogenesis is not known. Defects in APOE are a cause of sea-blue histiocyte disease (SBHD); also known as sea-blue histiocytosis. This disorder is characterized by splenomegaly, mild thrombocytopenia and, in the bone marrow, numerous histiocytes containing cytoplasmic granules which stain bright blue with the usual hematologic stains. The syndrome is the consequence of an inherited metabolic defect analogous to Gaucher disease and other sphingolipidoses. Defects in APOE are a cause of lipoprotein glomerulopathy (LPG). LPG is an uncommon kidney disease characterized by proteinuria, progressive kidney failure, and distinctive lipoprotein thrombi in glomerular capillaries. It mainly affects people of Japanese and Chinese origin. The disorder has rarely been described in Caucasians. Belongs to the apolipoprotein A1/A4/E family.

Protein type: Lipid-binding; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: Golgi apparatus; extracellular space; microtubule; lysosome; endoplasmic reticulum; dendrite; early endosome; extracellular region; nuclear envelope; extracellular matrix; chylomicron; extrinsic to external side of plasma membrane; cell soma; membrane; late endosome; cytoplasm; plasma membrane; nucleus; vesicle

Molecular Function: lipid transporter activity; heparin binding; identical protein binding; protein homodimerization activity; metal chelating activity; beta-amyloid binding; cholesterol binding; antioxidant activity; protein binding; low-density lipoprotein receptor binding; hydroxyapatite binding; cholesterol transporter activity; phospholipid binding; lipid binding; tau protein binding

Biological Process: lipoprotein catabolic process; phototransduction, visible light; negative regulation of MAP kinase activity; cGMP-mediated signaling; positive regulation of axon extension; positive regulation of membrane protein ectodomain proteolysis; axon regeneration in the peripheral nervous system; synaptic transmission, cholinergic; intracellular transport; triacylglycerol catabolic process; oligodendrocyte differentiation; negative regulation of neuron apoptosis; cholesterol catabolic process; long-chain fatty acid transport; cholesterol metabolic process; regulation of Cdc42 protein signal transduction; positive regulation of nitric-oxide synthase activity; negative regulation of blood coagulation; lipoprotein metabolic process; positive regulation of lipid biosynthetic process; regulation of axon extension; negative regulation of blood vessel endothelial cell migration; maintenance of cellular localization; cholesterol homeostasis; response to reactive oxygen species; response to ethanol; positive regulation of cGMP biosynthetic process; regulation of gene expression; lipoprotein biosynthetic process; protein import; negative regulation of endothelial cell proliferation; nitric oxide mediated signal transduction; regulation of neuronal synaptic plasticity; response to dietary excess; vasodilation; response to insulin stimulus; positive regulation of low-density lipoprotein receptor catabolic process; phospholipid efflux; negative regulation of cholesterol biosynthetic process; retinoid metabolic process; aging; receptor-mediated endocytosis; response to retinoic acid; negative regulation of lipid biosynthetic process; neurite regeneration; cytoskeleton organization and biogenesis; cholesterol efflux; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; triacylglycerol metabolic process; reverse cholesterol transport; fatty acid homeostasis; negative regulation of inflammatory response; artery morphogenesis

Disease: Macular Degeneration, Age-related, 1; Alzheimer Disease 2; Alzheimer Disease 4; Lipoprotein Glomerulopathy; Sea-blue Histiocyte Disease

Research Articles on APOE

Similar Products

Product Notes

The APOE apoe (Catalog #AAA3211573) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOE antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the APOE apoe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVLWAALLVT FLAGCQAKVE QAVETEPEPE LRQQTEWQSG QRWELALGRF. It is sometimes possible for the material contained within the vial of "APOE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.