Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human beta-NGF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15 kDa.)

beta-NGF recombinant protein

Recombinant Human beta-NGF Protein

Gene Names
NGF; NGFB; HSAN5; Beta-NGF
Purity
>95% by SDS-PAGE.
Synonyms
beta-NGF; Recombinant Human beta-NGF Protein; Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB; beta-NGF recombinant protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM PB, 250mM NaCl, pH 7.0.
Sequence
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Sequence Length
241
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human beta-NGF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15 kDa.)

SDS-Page (Recombinant Human beta-NGF Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15 kDa.)
Related Product Information for beta-NGF recombinant protein
Description: Recombinant Human beta-NGF Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ser122-Arg239) of human beta-NGF (Accession #P01138) fused with a No tag.

Background: This protein is a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis.
Product Categories/Family for beta-NGF recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Beta-nerve growth factor
NCBI Official Synonym Full Names
nerve growth factor
NCBI Official Symbol
NGF
NCBI Official Synonym Symbols
NGFB; HSAN5; Beta-NGF
NCBI Protein Information
beta-nerve growth factor
UniProt Protein Name
Beta-nerve growth factor
UniProt Gene Name
NGF
UniProt Synonym Gene Names
NGFB; Beta-NGF
UniProt Entry Name
NGF_HUMAN

NCBI Description

This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008]

Uniprot Description

NGF: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Homodimer. Belongs to the NGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p13.1

Cellular Component: extracellular space; Golgi lumen; cytoplasmic membrane-bound vesicle; extracellular region; endosome

Molecular Function: metalloendopeptidase inhibitor activity; protein binding; nerve growth factor receptor binding; growth factor activity; receptor signaling protein activity

Biological Process: response to nicotine; circadian rhythm; response to peptide hormone stimulus; nerve growth factor receptor signaling pathway; activation of MAPKK activity; positive regulation of apoptosis; adult locomotory behavior; regulation of neuron differentiation; positive regulation of axon extension; response to glucocorticoid stimulus; regulation of neurotransmitter secretion; response to lipopolysaccharide; regulation of caspase activity; sensory perception of pain; regulation of axonogenesis; negative regulation of cell cycle; nerve growth factor processing; response to radiation; cell-cell signaling; small GTPase mediated signal transduction; negative regulation of neuron apoptosis; response to electrical stimulus; inflammatory response; response to drug; positive regulation of neuron maturation; phosphoinositide-mediated signaling; positive regulation of protein amino acid autophosphorylation; positive regulation of nerve growth factor receptor signaling pathway; regulation of release of sequestered calcium ion into cytosol; memory; peripheral nervous system development; neuron apoptosis; induction of apoptosis via death domain receptors; response to mechanical stimulus; phospholipase C activation; response to ozone; Ras protein signal transduction; positive regulation of axonogenesis; positive regulation of transcription factor activity; neurite morphogenesis; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type V

Research Articles on beta-NGF

Similar Products

Product Notes

The beta-NGF ngf (Catalog #AAA9141922) is a Recombinant Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SSSHPIFHRG EFSVCDSVSV WVGDKTTATD IKGKEVMVLG EVNINNSVFK QYFFETKCRD PNPVDSGCRG IDSKHWNSYC TTTHTFVKAL TMDGKQAAWR FIRIDTACVC VLSRKAVR. It is sometimes possible for the material contained within the vial of "beta-NGF, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.