Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human APOA2 Polyclonal Antibody | anti-APOA2 antibody

APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2) (MaxLight 405)

Gene Names
APOA2; apoAII; Apo-AII; ApoA-II
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOA2; Polyclonal Antibody; APOA2 (Apolipoprotein A-II; Apo-AII; ApoA-II; Apolipoprotein A2) (MaxLight 405); anti-APOA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human APOA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-APOA2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human APOA2, aa1-100 (NP_001634.1).
Immunogen Sequence
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-APOA2 antibody
Apolipoprotein A2 (ApoA2) is a major protein component of serum HDL. It is produced by the liver and is involved in cholesteryl ester formation and cholesterol transport from tissues to the liver. Polymorphisms of ApoA2 are associated with disorders of cholesterol and fatty acid metabolism. ApoA2 can form disulfide-linked 17kD homodimers and heterodimers with other apolipoproteins.
Product Categories/Family for anti-APOA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
336
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,175 Da
NCBI Official Full Name
apolipoprotein A-II preproprotein
NCBI Official Synonym Full Names
apolipoprotein A-II
NCBI Official Symbol
APOA2
NCBI Official Synonym Symbols
apoAII; Apo-AII; ApoA-II
NCBI Protein Information
apolipoprotein A-II; apolipoprotein A2
UniProt Protein Name
Apolipoprotein A-II
Protein Family
UniProt Gene Name
APOA2
UniProt Synonym Gene Names
Apo-AII; ApoA-II
UniProt Entry Name
APOA2_HUMAN

NCBI Description

This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008]

Uniprot Description

APOA2: May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Belongs to the apolipoprotein A2 family.

Protein type: Endoplasmic reticulum; Secreted, signal peptide; Secreted; Lipid-binding

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: chylomicron; endoplasmic reticulum lumen; early endosome; extracellular region; cytosol

Molecular Function: lipid transporter activity; protein binding; protein homodimerization activity; lipase inhibitor activity; protein heterodimerization activity; cholesterol transporter activity; cholesterol binding; phospholipid binding; phosphatidylcholine binding; lipid binding; high-density lipoprotein binding; apolipoprotein receptor binding

Biological Process: positive regulation of catalytic activity; phototransduction, visible light; viral reproduction; protein folding; negative regulation of cholesterol transport; response to glucocorticoid stimulus; regulation of protein stability; diacylglycerol catabolic process; positive regulation of lipid catabolic process; cellular lipid metabolic process; negative regulation of lipase activity; negative regulation of lipid catabolic process; regulation of cholesterol absorption; phospholipid efflux; response to glucose stimulus; retinoid metabolic process; response to drug; cholesterol metabolic process; organ regeneration; protein amino acid oxidation; phospholipid catabolic process; positive regulation of interleukin-8 biosynthetic process; cholesterol efflux; lipoprotein metabolic process; negative regulation of cytokine secretion during immune response; cholesterol homeostasis; triacylglycerol metabolic process; reverse cholesterol transport; response to estrogen stimulus; peptidyl-methionine modification; phosphatidylcholine biosynthetic process; acute inflammatory response

Disease: Hypercholesterolemia, Familial

Research Articles on APOA2

Similar Products

Product Notes

The APOA2 apoa2 (Catalog #AAA6370039) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOA2 apoa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.