APLP1 Polyclonal Antibody | anti-APLP1 antibody

Anti-APLP1 Antibody

Cat. Num. AAA177972

• Gene Names: APLP1; APLP
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: APLP1; Polyclonal Antibody; Anti-APLP1 Antibody; Amyloid-like protein 1; AMYLOID BETA A4 PRECURSOR-LIKE PROTEIN 1; AMYLOID PRECURSOR-LIKE PROTEIN; Amyloid-like protein 1 precursor; APLP 1; APLP; APLP-1; Aplp1; APLP1_HUMAN; C30 antibody; amyloid beta (A4) precursor-like protein 1; anti-APLP1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 651

• Applicable Applications for anti-APLP1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- APLP1 Picoband antibody, MBS177972, Western blottingAll lanes: Anti APLP1 (MBS177972) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: SGC Whole Cell Lysate at 40ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 85KD )

Immunohistochemistry (IHC)

(Anti- APLP1 Picoband antibody, MBS177972,IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- APLP1 Picoband antibody, MBS177972,IHC(P)IHC(P): Rat Brain Tissue )

Related Product Information for anti-APLP1 antibody

Description: Rabbit IgG polyclonal antibody for Amyloid-like protein 1(APLP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF.

References

1. Lenkkeri, U., Kestila, M., Lamerdin, J., McCready, P., Adamson, A., Olsen, A., Tryggvason, K. Structure of the human amyloid-precursor-like protein gene APLP1 at 19q13.1. Hum. Genet. 102: 192-196, 1998.

NCBI and Uniprot Product Information

• NCBI GI #: 67782338
• NCBI GeneID: 333
• NCBI Accession #: NP_001019978.1
• NCBI GenBank Nucleotide #: NM_001024807.2
• UniProt Accession #: P51693; O00113; Q96A92
• Molecular Weight: 72,247 Da
• NCBI Official Full Name: amyloid-like protein 1 isoform 1
• NCBI Official Synonym Full Names: amyloid beta precursor like protein 1
• NCBI Official Symbol: APLP1
• NCBI Official Synonym Symbols: APLP
• NCBI Protein Information: amyloid-like protein 1
• UniProt Protein Name: Amyloid-like protein 1
• Protein Family: Amyloid-like protein
• UniProt Gene Name: APLP1
• UniProt Synonym Gene Names: APLP; APLP-1
• UniProt Entry Name: APLP1_HUMAN

NCBI Description

This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

APLP1: May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding. Couples to JIP signal transduction through C-terminal binding. May interact with cellular G-protein signaling pathways. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I. Belongs to the APP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: basement membrane; integral to membrane; perinuclear region of cytoplasm; plasma membrane

Molecular Function: alpha-2A adrenergic receptor binding; alpha-2B adrenergic receptor binding; alpha-2C adrenergic receptor binding; heparin binding; identical protein binding; protein binding; transition metal ion binding

Biological Process: apoptosis; cell adhesion; endocytosis; G-protein signaling, adenylate cyclase inhibiting pathway; negative regulation of cAMP biosynthetic process; nervous system development; organ morphogenesis