Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ANXA11Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ANXA11 Polyclonal Antibody | anti-ANXA11 antibody

ANXA11 Antibody - middle region

Gene Names
ANXA11; ALS23; ANX11; CAP50; CAP-50
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ANXA11; Polyclonal Antibody; ANXA11 Antibody - middle region; anti-ANXA11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYP
Sequence Length
505
Applicable Applications for anti-ANXA11 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ANXA11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ANXA11Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANXA11Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ANXA11 antibody
This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
311
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
annexin A11 isoform 1
NCBI Official Synonym Full Names
annexin A11
NCBI Official Symbol
ANXA11
NCBI Official Synonym Symbols
ALS23; ANX11; CAP50; CAP-50
NCBI Protein Information
annexin A11
UniProt Protein Name
Annexin A11
Protein Family
UniProt Gene Name
ANXA11
UniProt Synonym Gene Names
ANX11; CAP-50
UniProt Entry Name
ANX11_HUMAN

NCBI Description

This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015]

Uniprot Description

ANXA11: a calcium/phospholipid-binding protein found throughout the nucleoplasm at interphase and at the mitotic phase is concentrated at the loop-like structure around the mitotic apparatus. May interact with calcyclin (S100A6) in vivo. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Lipid-binding; Nuclear envelope; Motility/polarity/chemotaxis; Calcium-binding

Chromosomal Location of Human Ortholog: 10q23

Cellular Component: nucleoplasm; specific granule; azurophil granule; membrane; cytoplasm; melanosome; spindle; nuclear envelope; phagocytic vesicle; midbody

Molecular Function: protein binding; phosphatidylethanolamine binding; calcium-dependent phospholipid binding; calcium ion binding; calcium-dependent protein binding

Biological Process: response to calcium ion; phagocytosis

Research Articles on ANXA11

Similar Products

Product Notes

The ANXA11 anxa11 (Catalog #AAA3223341) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA11 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANXA11 anxa11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGAPGAGYPP VPPGGFGQPP SAQQPVPPYG MYPPPGGNPP SRMPSYPPYP. It is sometimes possible for the material contained within the vial of "ANXA11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.