Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ANP32E Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit ANP32E Polyclonal Antibody | anti-ANP32E antibody

ANP32E Rabbit pAb

Gene Names
ANP32E; LANPL; LANP-L
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
ANP32E; Polyclonal Antibody; ANP32E Rabbit pAb; LANP-L; LANPL; anti-ANP32E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE
Applicable Applications for anti-ANP32E antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ANP32E (NP_112182.1).
Positive Samples
K-562, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ANP32E Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ANP32E Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
acidic leucine-rich nuclear phosphoprotein 32 family member E isoform 1
NCBI Official Synonym Full Names
acidic (leucine-rich) nuclear phosphoprotein 32 family, member E
NCBI Official Symbol
ANP32E
NCBI Official Synonym Symbols
LANPL; LANP-L
NCBI Protein Information
acidic leucine-rich nuclear phosphoprotein 32 family member E; LANP-like protein; leucine-rich acidic nuclear protein like
UniProt Protein Name
Acidic leucine-rich nuclear phosphoprotein 32 family member E
UniProt Gene Name
ANP32E
UniProt Synonym Gene Names
LANP-L
UniProt Entry Name
AN32E_HUMAN

Uniprot Description

LANP-L: Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis process by modulating PP2A activity. Belongs to the ANP32 family.

Protein type: Inhibitor; Protein phosphatase, regulatory subunit; Vesicle; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q21.2

Cellular Component: cytoplasmic membrane-bound vesicle; nucleus

Molecular Function: phosphatase inhibitor activity; histone binding

Biological Process: negative regulation of catalytic activity; histone exchange

Research Articles on ANP32E

Similar Products

Product Notes

The ANP32E anp32e (Catalog #AAA9142668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANP32E Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ANP32E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ANP32E anp32e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEMKKKINLE LRNRSPEEVT ELVLDNCLCV NGEIEGLNDT FKELEFLSMA NVELSSLARL PSLNKLRKLE. It is sometimes possible for the material contained within the vial of "ANP32E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.