Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ANGPTL3Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ANGPTL3 Polyclonal Antibody | anti-ANGPTL3 antibody

ANGPTL3 Antibody - N-terminal region

Gene Names
Angptl3; hypl
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ANGPTL3; Polyclonal Antibody; ANGPTL3 Antibody - N-terminal region; anti-ANGPTL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLRTNEIKEEEKE
Sequence Length
455
Applicable Applications for anti-ANGPTL3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ANGPTL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ANGPTL3Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANGPTL3Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ANGPTL3 antibody
This gene encodes a member of the angiopoietin-like family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, which may inhibit triglyceride metabolism. Homozygous knockout mice for this gene exhibit reduced plasma lipid concentrations, including reduced plasma triglyceride concentrations, and enhanced activity of enzymes involved in triglyceride metabolism.
Product Categories/Family for anti-ANGPTL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
angiopoietin-related protein 3 preproprotein
NCBI Official Synonym Full Names
angiopoietin-like 3
NCBI Official Symbol
Angptl3
NCBI Official Synonym Symbols
hypl
NCBI Protein Information
angiopoietin-related protein 3
UniProt Protein Name
Angiopoietin-related protein 3
UniProt Gene Name
Angptl3
UniProt Entry Name
ANGL3_MOUSE

NCBI Description

This gene encodes a member of the angiopoietin-like family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, which may inhibit triglyceride metabolism. Homozygous knockout mice for this gene exhibit reduced plasma lipid concentrations, including reduced plasma triglyceride concentrations, and enhanced activity of enzymes involved in triglyceride metabolism. [provided by RefSeq, Aug 2015]

Uniprot Description

ANGPTL3: Defects in ANGPTL3 are the cause of familial hypobetalipoproteinemia type 2 (FHBL2); also called combined hypobetalipoproteinemia familial. FHBL2 is a disorder of lipid metabolism characterized by less than 5th percentile age- and sex-specific levels of low density lipoproteins, and dietary fat malabsorption. Affected individuals present with combined hypolipidemia, consisting of extremely low plasma levels of LDL cholesterol, HDL cholesterol, and triglycerides.

Protein type: Cell adhesion; Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; Inhibitor

Cellular Component: Golgi apparatus; extracellular space; cell surface; early endosome; extracellular region

Molecular Function: integrin binding; enzyme inhibitor activity; phospholipase inhibitor activity; growth factor activity

Biological Process: cholesterol metabolic process; phospholipid catabolic process; glycerol metabolic process; cell-matrix adhesion; lipid homeostasis; positive regulation of lipid catabolic process; fatty acid metabolic process; signal transduction; positive regulation of angiogenesis; sequestering of lipid; cholesterol homeostasis; triacylglycerol metabolic process; acylglycerol homeostasis; phospholipid metabolic process; negative regulation of catalytic activity; artery morphogenesis; positive regulation of lipid metabolic process; negative regulation of lipoprotein lipase activity; positive regulation of cell migration; phospholipid homeostasis

Research Articles on ANGPTL3

Similar Products

Product Notes

The ANGPTL3 angptl3 (Catalog #AAA3223709) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANGPTL3 Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPTL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANGPTL3 angptl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLLQLGHGLK DFVHKTKGQI NDIFQKLNIF DQSFYDLSLR TNEIKEEEKE. It is sometimes possible for the material contained within the vial of "ANGPTL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.