Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PLTPSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PLTP Polyclonal Antibody | anti-PLTP antibody

PLTP Antibody - N-terminal region

Gene Names
PLTP; BPIFE; HDLCQ9
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLTP; Polyclonal Antibody; PLTP Antibody - N-terminal region; anti-PLTP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISE
Sequence Length
493
Applicable Applications for anti-PLTP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLTP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PLTPSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PLTPSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PLTP antibody
The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PLTP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
phospholipid transfer protein isoform c
NCBI Official Synonym Full Names
phospholipid transfer protein
NCBI Official Symbol
PLTP
NCBI Official Synonym Symbols
BPIFE; HDLCQ9
NCBI Protein Information
phospholipid transfer protein
UniProt Protein Name
Phospholipid transfer protein
UniProt Gene Name
PLTP
UniProt Entry Name
PLTP_HUMAN

NCBI Description

The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PLTP: Converts HDL into larger and smaller particles. May play a key role in extracellular phospholipid transport and modulation of hdl particles. Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Lipid-binding; Secreted

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: extracellular space; extracellular region

Molecular Function: lipid binding

Biological Process: sperm motility; vitamin E biosynthetic process; lipid metabolic process; lipid transport

Research Articles on PLTP

Similar Products

Product Notes

The PLTP pltp (Catalog #AAA3221545) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLTP Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLTP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLTP pltp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFPGCKIRVT SKALELVKQE GLRFLEQELE TITIPDLRGK EGHFYYNISE. It is sometimes possible for the material contained within the vial of "PLTP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.