Rabbit anti-Mouse Angiotensin I Converting Enzyme Polyclonal Antibody | anti-ACE antibody
Polyclonal Antibody to Angiotensin I Converting Enzyme (ACE)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-FFTSLGL SPMPPEFWAE SMLEKPTDGR EVVCHASAWD FYNRKDFRIK QCTRVTMEQL
Immunohistochemistry: 5-20ug/mL;1:25-100
Immunocytochemistry: 5-20ug/mL;1:25-100
Optimal working dilutions must be determined by end user.
NCBI and Uniprot Product Information
Uniprot Description
ACE: Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. Genetic variations in ACE may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Defects in ACE are a cause of renal tubular dysgenesis (RTD). RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). Genetic variations in ACE are associated with susceptibility to microvascular complications of diabetes type 3 (MVCD3). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Defects in ACE are a cause of susceptibility to intracerebral hemorrhage (ICH). A pathological condition characterized by bleeding into one or both cerebral hemispheres including the basal ganglia and the cerebral cortex. It is often associated with hypertension and craniocerebral trauma. Intracerebral bleeding is a common cause of stroke. Belongs to the peptidase M2 family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 3.4.15.1; Membrane protein, integral; Protease
Chromosomal Location of Human Ortholog: 11 E1|11 68.84 cM
Cellular Component: basal plasma membrane; brush border membrane; cytoplasm; endosome; external side of plasma membrane; extracellular exosome; extracellular region; extracellular space; integral component of membrane; lysosome; membrane; plasma membrane; vesicle
Molecular Function: actin binding; bradykinin receptor binding; carboxypeptidase activity; chloride ion binding; drug binding; endopeptidase activity; exopeptidase activity; hydrolase activity; metal ion binding; metallopeptidase activity; mitogen-activated protein kinase binding; mitogen-activated protein kinase kinase binding; peptidase activity; peptidyl-dipeptidase activity; protein binding; tripeptidyl-peptidase activity; zinc ion binding
Biological Process: alveolus development; arachidonic acid secretion; beta-amyloid metabolic process; bradykinin catabolic process; cell proliferation in bone marrow; eating behavior; embryonic development ending in birth or egg hatching; heart contraction; hormone catabolic process; kidney development; negative regulation of blood vessel diameter; negative regulation of calcium ion import; negative regulation of gene expression; negative regulation of glucose import; negative regulation of protein binding; neutrophil mediated immunity; organ regeneration; peptide catabolic process; peptide metabolic process; positive regulation of apoptosis; positive regulation of blood pressure; positive regulation of inflammatory response; positive regulation of neurogenesis; positive regulation of peptidyl-cysteine S-nitrosylation; positive regulation of peptidyl-tyrosine autophosphorylation; positive regulation of protein binding; positive regulation of systemic arterial blood pressure; posttranscriptional regulation of gene expression; proteolysis; regulation of angiotensin metabolic process; regulation of blood pressure; regulation of hematopoietic stem cell proliferation; regulation of smooth muscle cell migration; regulation of systemic arterial blood pressure by renin-angiotensin; response to lipopolysaccharide; sensory perception of pain; spermatogenesis; vasoconstriction
Research Articles on ACE
Similar Products
Product Notes
The ACE ace (Catalog #AAA2026856) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Angiotensin I Converting Enzyme (ACE) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Angiotensin I Converting Enzyme can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) Formalin/Paraffin, ELISA (EIA). Western blotting: 0.2-2ug/mL;1:250-2500 Immunohistochemistry: 5-20ug/mL;1:25-100 Immunocytochemistry: 5-20ug/mL;1:25-100 Optimal working dilutions must be determined by end user. . Researchers should empirically determine the suitability of the ACE ace for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and S-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-FFTSLGL SPMPPEFWAE SMLEKPTDGR EVVCHASAWD FYNRKDFRIK QCTRVTMEQL. It is sometimes possible for the material contained within the vial of "Angiotensin I Converting Enzyme, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.