Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Angiotensin I Converting Enzyme 2 (ACE2) Recombinant Protein | ACE2 recombinant protein

Recombinant Angiotensin I Converting Enzyme 2 (ACE2)

Gene Names
Ace; CD143; AW208573
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Angiotensin I Converting Enzyme 2 (ACE2); Recombinant Angiotensin I Converting Enzyme 2 (ACE2); ACE2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-FFTSLGL SPMPPEFWAE SMLEKPTDGR EVVCHASAWD FYNRKDFRIK QCTRVTMEQL ATVHHEMGHV QYYLQYKDL
Sequence Length
732
Applicable Applications for ACE2 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Mus musculus (Mouse)
Expression System
Prokaryotic expression
Residues
Phe334~Leu409 (Accession # P09470) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.8kDa
NCBI Official Full Name
angiotensin-converting enzyme isoform 2
NCBI Official Synonym Full Names
angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
NCBI Official Symbol
Ace
NCBI Official Synonym Symbols
CD143; AW208573
NCBI Protein Information
angiotensin-converting enzyme; kininase II; dipeptidyl peptidase; dipeptidyl carboxypeptidase I
UniProt Protein Name
Angiotensin-converting enzyme
UniProt Gene Name
Ace
UniProt Synonym Gene Names
Dcp1; ACE
UniProt Entry Name
ACE_MOUSE

Uniprot Description

ACE: Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. Genetic variations in ACE may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Defects in ACE are a cause of renal tubular dysgenesis (RTD). RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). Genetic variations in ACE are associated with susceptibility to microvascular complications of diabetes type 3 (MVCD3). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Defects in ACE are a cause of susceptibility to intracerebral hemorrhage (ICH). A pathological condition characterized by bleeding into one or both cerebral hemispheres including the basal ganglia and the cerebral cortex. It is often associated with hypertension and craniocerebral trauma. Intracerebral bleeding is a common cause of stroke. Belongs to the peptidase M2 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.15.1; Protease; Membrane protein, integral

Cellular Component: extracellular space; membrane; lysosome; brush border membrane; cytoplasm; basal plasma membrane; extracellular region; plasma membrane; integral to membrane; vesicle; endosome; external side of plasma membrane

Molecular Function: metallopeptidase activity; zinc ion binding; carboxypeptidase activity; mitogen-activated protein kinase kinase binding; mannosyl-oligosaccharide mannosidase activity; metal ion binding; drug binding; actin binding; glucosidase activity; endopeptidase activity; mitogen-activated protein kinase binding; amylase activity; chloride ion binding; peptidyl-dipeptidase activity; tripeptidyl-peptidase activity; hydrolase activity; trehalase activity; peptidase activity; protein binding; fucosidase activity; lytic transglycosylase activity; galactosidase activity; hexosaminidase activity; bradykinin receptor binding; exopeptidase activity; mannosidase activity

Biological Process: positive regulation of protein binding; positive regulation of apoptosis; neutrophil mediated immunity; positive regulation of systemic arterial blood pressure; regulation of angiotensin metabolic process; response to lipopolysaccharide; sensory perception of pain; proteolysis; peptide metabolic process; regulation of smooth muscle cell migration; beta-amyloid metabolic process; regulation of blood pressure; peptide catabolic process; negative regulation of protein binding; kidney development; vasoconstriction; positive regulation of neurogenesis; organ regeneration; eating behavior; arachidonic acid secretion; regulation of systemic arterial blood pressure by renin-angiotensin; heart contraction; hormone catabolic process; spermatogenesis; alveolus development; positive regulation of inflammatory response

Research Articles on ACE2

Similar Products

Product Notes

The ACE2 ace (Catalog #AAA2009765) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Angiotensin I Converting Enzyme 2 (ACE2) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the ACE2 ace for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-FFTSLGL SPMPPEFWAE SMLEKPTDGR EVVCHASAWD FYNRKDFRIK QCTRVTMEQL ATVHHEMGHV QYYLQYKDL. It is sometimes possible for the material contained within the vial of "Angiotensin I Converting Enzyme 2 (ACE2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.