Western Blot (WB)
(WB Suggested Anti-AMIGO3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Rabbit AMIGO3 Polyclonal Antibody | anti-AMIGO3 antibody
AMIGO3 antibody - N-terminal region
Gene Names
AMIGO3; ALI3; AMIGO-3
Reactivity
Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AMIGO3; Polyclonal Antibody; AMIGO3 antibody - N-terminal region; anti-AMIGO3 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL
Sequence Length
504
Applicable Applications for anti-AMIGO3 antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AMIGO3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-AMIGO3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Western Blot (WB)
(WB Suggested Anti-AMIGO3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-AMIGO3 antibody
This is a rabbit polyclonal antibody against AMIGO3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.
Target Description: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.
Product Categories/Family for anti-AMIGO3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
amphoterin-induced protein 3
NCBI Official Synonym Full Names
adhesion molecule with Ig like domain 3
NCBI Official Symbol
AMIGO3
NCBI Official Synonym Symbols
ALI3; AMIGO-3
NCBI Protein Information
amphoterin-induced protein 3
UniProt Protein Name
Amphoterin-induced protein 3
Protein Family
UniProt Gene Name
AMIGO3
UniProt Synonym Gene Names
ALI3; KIAA1851; UNQ6084/PRO20089
UniProt Entry Name
AMGO3_HUMAN
Uniprot Description
AMIGO3: May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain. Belongs to the immunoglobulin superfamily. AMIGO family.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 3p21
Cellular Component: integral to membrane
Biological Process: heterophilic cell adhesion; brain development
Research Articles on AMIGO3
Similar Products
Product Notes
The AMIGO3 amigo3 (Catalog #AAA3212476) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMIGO3 antibody - N-terminal region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's AMIGO3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AMIGO3 amigo3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTWLVLLGTL LCMLRVGLGT PDSEGFPPRA LHNCPYKCIC AADLLSCTGL. It is sometimes possible for the material contained within the vial of "AMIGO3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
