Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AMBPSample Type: Human 721_BAntibody Dilution: 1.0ug/mlAMBP is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit AMBP Polyclonal Antibody | anti-AMBP antibody

AMBP antibody - N-terminal region

Gene Names
AMBP; A1M; HCP; ITI; UTI; EDC1; HI30; ITIL; IATIL; ITILC
Reactivity
Cow, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AMBP; Polyclonal Antibody; AMBP antibody - N-terminal region; anti-AMBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFS
Sequence Length
352
Applicable Applications for anti-AMBP antibody
Western Blot (WB)
Homology
Cow: 83%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Pig: 92%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AMBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AMBPSample Type: Human 721_BAntibody Dilution: 1.0ug/mlAMBP is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: AMBPSample Type: Human 721_BAntibody Dilution: 1.0ug/mlAMBP is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(Host: RabbitTarget Name: AMBPSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AMBPSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: AMBPSample Type: Human HepG2Antibody Dilution: 1.0ug/mlAMBP is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: AMBPSample Type: Human HepG2Antibody Dilution: 1.0ug/mlAMBP is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB)

(WB Suggested Anti-AMBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-AMBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-AMBP antibody
This is a rabbit polyclonal antibody against AMBP. It was validated on Western Blot

Target Description: This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes.
Product Categories/Family for anti-AMBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
259
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
protein AMBP preproprotein
NCBI Official Synonym Full Names
alpha-1-microglobulin/bikunin precursor
NCBI Official Symbol
AMBP
NCBI Official Synonym Symbols
A1M; HCP; ITI; UTI; EDC1; HI30; ITIL; IATIL; ITILC
NCBI Protein Information
protein AMBP
UniProt Protein Name
Protein AMBP
Protein Family
UniProt Gene Name
AMBP
UniProt Synonym Gene Names
HCP; ITIL; Protein HC; ITI-LC
UniProt Entry Name
AMBP_HUMAN

NCBI Description

This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008]

Uniprot Description

AMBP: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9q32-q33

Cellular Component: extracellular space; cell surface; intracellular membrane-bound organelle; plasma membrane; extracellular region

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; protein homodimerization activity; calcium oxalate binding; IgA binding; heme binding; calcium channel inhibitor activity

Biological Process: negative regulation of JNK cascade; receptor-mediated endocytosis; viral reproduction; heme catabolic process; negative regulation of immune response; protein catabolic process; female pregnancy; cell adhesion; protein-chromophore linkage

Research Articles on AMBP

Similar Products

Product Notes

The AMBP ambp (Catalog #AAA3214210) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AMBP antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AMBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AMBP ambp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCEETSGAYE KTDTDGKFLY HKSKWNITME SYVVHTNYDE YAIFLTKKFS. It is sometimes possible for the material contained within the vial of "AMBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.