Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ALDH7A1 expression in rat liver extract (lane 1), HEPA whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). ALDH7A1 at 58KD was detected using rabbit anti- ALDH7A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit ALDH7A1 Polyclonal Antibody | anti-ALDH7A1 antibody

Anti-ALDH7A1 Antibody

Gene Names
ALDH7A1; EPD; PDE; ATQ1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
ALDH7A1; Polyclonal Antibody; Anti-ALDH7A1 Antibody; Antiquitin 1; Antiquitin; Antiquitin-1; ATQ1; EPD; PDE; P49419; Alpha-aminoadipic semialdehyde dehydrogenase; aldehyde dehydrogenase 7 family member A1; anti-ALDH7A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
539
Applicable Applications for anti-ALDH7A1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ALDH7A1 expression in rat liver extract (lane 1), HEPA whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). ALDH7A1 at 58KD was detected using rabbit anti- ALDH7A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of ALDH7A1 expression in rat liver extract (lane 1), HEPA whole cell lysates (lane 2) and HELA whole cell lysates (lane 3). ALDH7A1 at 58KD was detected using rabbit anti- ALDH7A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(ALDH7A1 was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ALDH7A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (ALDH7A1 was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ALDH7A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(ALDH7A1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- ALDH7A1 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (ALDH7A1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- ALDH7A1 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-ALDH7A1 antibody
Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection.
Background: Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.
References
1. Brocker C, Lassen N, Estey T, Pappa A, Cantore M, Orlova VV, Chavakis T, Kavanagh KL, Oppermann U, Vasiliou V (June 2010). "Aldehyde dehydrogenase 7A1 (ALDH7A1) is a novel enzyme involved in cellular defense against hyperosmotic stress". J. Biol. Chem. 285 (24): 18452-63.
2. Skvorak AB, Robertson NG, Yin Y, Weremowicz S, Her H, Bieber FR, Beisel KW, Lynch ED, Beier DR, Morton CC (December 1997). "An ancient conserved gene expressed in the human inner ear: identification, expression analysis, and chromosomal mapping of human and mouse antiquitin (ATQ1)". Genomics 46 (2): 191-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
501
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,411 Da
NCBI Official Full Name
alpha-aminoadipic semialdehyde dehydrogenase isoform 1
NCBI Official Synonym Full Names
aldehyde dehydrogenase 7 family member A1
NCBI Official Symbol
ALDH7A1
NCBI Official Synonym Symbols
EPD; PDE; ATQ1
NCBI Protein Information
alpha-aminoadipic semialdehyde dehydrogenase
UniProt Protein Name
Alpha-aminoadipic semialdehyde dehydrogenase
UniProt Gene Name
ALDH7A1
UniProt Synonym Gene Names
ATQ1; Alpha-AASA dehydrogenase; P6c dehydrogenase

NCBI Description

The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified. [provided by RefSeq, Jan 2011]

Uniprot Description

ALDH7A1: Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism. Defects in ALDH7A1 are the cause of pyridoxine-dependent epilepsy (PDE). PDE is characterized by a combination of various seizure types. It usually occurs in the first hours of life and is unresponsive to standard anticonvulsants, responding only to immediate administration of pyridoxine hydrochloride. Belongs to the aldehyde dehydrogenase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - histidine; Amino Acid Metabolism - lysine degradation; Amino Acid Metabolism - tryptophan; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Carbohydrate Metabolism - ascorbate and aldarate; Carbohydrate Metabolism - butanoate; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - propanoate; Carbohydrate Metabolism - pyruvate; EC 1.2.1.3; EC 1.2.1.31; EC 1.2.1.8; Lipid Metabolism - fatty acid; Lipid Metabolism - glycerolipid; Mitochondrial; Other Amino Acids Metabolism - beta-alanine; Oxidoreductase; Secondary Metabolites Metabolism - limonene and pinene degradation

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: cytoplasm; mitochondrial matrix; mitochondrion

Molecular Function: aldehyde dehydrogenase (NAD) activity; betaine-aldehyde dehydrogenase activity; L-aminoadipate-semialdehyde dehydrogenase activity; protein binding

Biological Process: aldehyde metabolic process; choline catabolic process; lysine catabolic process; sensory perception of sound

Disease: Epilepsy, Pyridoxine-dependent

Research Articles on ALDH7A1

Similar Products

Product Notes

The ALDH7A1 aldh7a1 (Catalog #AAA178794) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ALDH7A1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH7A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the ALDH7A1 aldh7a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALDH7A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.