Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ALDH3A2Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ALDH3A2 Polyclonal Antibody | anti-ALDH3A2 antibody

ALDH3A2 Antibody-middle region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ALDH3A2; Polyclonal Antibody; ALDH3A2 Antibody-middle region; fatty aldehyde dehydrogenase; Ahd3; Ahd-3; Aldh4; FALDH; Ahd-3r; Ahd3-r; Aldh4-r; AI194803; anti-ALDH3A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
ASPDYERIINLRHFKRLQSLLKGQKIAFGGEMDEATRYLAPTILTDVDPN
Applicable Applications for anti-ALDH3A2 antibody
Western Blot (WB)
Protein Size
484 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ALDH3A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ALDH3A2Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALDH3A2Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ALDH3A2 antibody
Description of Target: Catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length. Responsible for conversion of the sphingosine 1-phosphate (S1P) degradation product hexadecenal to hexadecenoic acid.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
53kDa
UniProt Protein Name
Fatty aldehyde dehydrogenase
UniProt Gene Name
Aldh3a2
UniProt Synonym Gene Names
Ahd-3; Ahd3; Aldh3; Aldh4
UniProt Entry Name
AL3A2_MOUSE

Uniprot Description

ALDH3A2: Catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length. Responsible for conversion of the sphingosine 1-phosphate (S1P) degradation product hexadecenal to hexadecenoic acid. Defects in ALDH3A2 are the cause of Sjoegren-Larsson syndrome (SLS). SLS is an autosomal recessive neurocutaneous disorder characterized by a combination of severe mental retardation, spastic di- or tetraplegia and congenital ichthyosis (increased keratinization). Ichthyosis is usually evident at birth, neurologic symptoms appear in the first or second year of life. Most patients have an IQ of less than 60. Additional clinical features include glistening white spots on the retina, seizures, short stature and speech defects. Belongs to the aldehyde dehydrogenase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - histidine; Carbohydrate Metabolism - ascorbate and aldarate; Carbohydrate Metabolism - propanoate; EC 1.2.1.3; Carbohydrate Metabolism - pyruvate; Oxidoreductase; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Membrane protein, integral; Amino Acid Metabolism - tryptophan; Mitochondrial; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Lipid Metabolism - glycerolipid; Lipid Metabolism - fatty acid; Amino Acid Metabolism - lysine degradation; Amino Acid Metabolism - arginine and proline; Secondary Metabolites Metabolism - limonene and pinene degradation; Other Amino Acids Metabolism - beta-alanine; Carbohydrate Metabolism - butanoate

Cellular Component: mitochondrion; membrane; intracellular membrane-bound organelle; endoplasmic reticulum; mitochondrial inner membrane; integral to membrane; peroxisome; nucleus; cytosol

Molecular Function: long-chain-alcohol oxidase activity; aldehyde dehydrogenase (NAD) activity; aldehyde dehydrogenase [NAD(P)+] activity; 3-chloroallyl aldehyde dehydrogenase activity; long-chain-aldehyde dehydrogenase activity; oxidoreductase activity; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor

Biological Process: phytol metabolic process; response to reactive oxygen species; epidermis development; central nervous system development; metabolic process; formaldehyde metabolic process; aldehyde metabolic process; sesquiterpenoid metabolic process; peripheral nervous system development

Similar Products

Product Notes

The ALDH3A2 aldh3a2 (Catalog #AAA3249839) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH3A2 Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH3A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALDH3A2 aldh3a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASPDYERIIN LRHFKRLQSL LKGQKIAFGG EMDEATRYLA PTILTDVDPN. It is sometimes possible for the material contained within the vial of "ALDH3A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.