Rabbit AKT1S1 Polyclonal Antibody | anti-AKT1S1 antibody

AKT1S1 antibody - C-terminal region

Cat. Num. AAA3208839

• Gene Names: AKT1S1; Lobe; PRAS40
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: AKT1S1; Polyclonal Antibody; AKT1S1 antibody - C-terminal region; anti-AKT1S1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE
• Sequence Length: 256

• Applicable Applications for anti-AKT1S1 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AKT1S1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-AKT1S1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in endothelial cells in blood vesselsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-AKT1S1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Related Product Information for anti-AKT1S1 antibody

This is a rabbit polyclonal antibody against AKT1S1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress. AKT1S1 may also play a role in nerve growth factor-mediated neuroprotection.AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM].

Product Categories/Family for anti-AKT1S1 antibody

Polyclonal; Neuroscience; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 400153980
• NCBI GeneID: 84335
• NCBI Accession #: NP_115751
• NCBI GenBank Nucleotide #: NM_032375
• UniProt Accession #: Q96B36
• Molecular Weight: 27kDa
• NCBI Official Full Name: proline-rich AKT1 substrate 1 isoform a
• NCBI Official Synonym Full Names: AKT1 substrate 1
• NCBI Official Symbol: AKT1S1
• NCBI Official Synonym Symbols: Lobe; PRAS40
• NCBI Protein Information: proline-rich AKT1 substrate 1
• UniProt Protein Name: Proline-rich AKT1 substrate 1
• Protein Family: Proline-rich AKT1 substrate
• UniProt Gene Name: AKT1S1
• UniProt Synonym Gene Names: PRAS40
• UniProt Entry Name: AKTS1_HUMAN

NCBI Description

AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Subunit of mTORC1, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Within mTORC1, AKT1S1 negatively regulates mTOR activity in a manner that is dependent on its phosphorylation state and binding to 14-3-3 proteins. Inhibits RHEB-GTP-dependent mTORC1 activation. Substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. May also play a role in nerve growth factor-mediated neuroprotection. Ref.6 Ref.8 Ref.9

Subunit structure: Part of the mammalian target of rapamycin complex 1 (mTORC1) which contains MTOR, MLST8, RPTOR, AKT1S1/PRAS40 and DEPTOR. mTORC1 binds to and is inhibited by FKBP12-rapamycin. Interacts directly with RPTOR. The phosphorylated form interacts with 14-3-3 proteins. Ref.5 Ref.8 Ref.9

Subcellular location: Cytoplasm › cytosol

By similarity. Note: Found in the cytosolic fraction of the brain

By similarity.

Tissue specificity: Widely expressed with highest levels of expression in liver and heart. Expressed at higher levels in cancer cell lines (e.g. A-549 and HeLa) than in normal cell lines (e.g. HEK293). Ref.5 Ref.6

Post-translational modification: Phosphorylated by AKT1. Phosphorylation relieves inhibitory function on mTORC1. Ref.5

Sequence caution: The sequence AAH00031.2 differs from that shown. Reason: Erroneous initiation.