Mouse anti-Human AKIP Polyclonal Antibody | anti-AURKAIP1 antibody

AKIP (Aurora Kinase A-interacting Protein, AURKA-interacting Protein, AIP, AURKAIP1, FLJ20608)

Cat. Num. AAA645541

• Gene Names: AURKAIP1; AIP; AKIP
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: AKIP; Polyclonal Antibody; AKIP (Aurora Kinase A-interacting Protein; AURKA-interacting Protein; AIP; AURKAIP1; FLJ20608); Anti -AKIP (Aurora Kinase A-interacting Protein; anti-AURKAIP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human AURKAIP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK

• Applicable Applications for anti-AURKAIP1 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human AURKAIP1, aa1-199 (NP_060370.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AURKAIP1 expression in transfected 293T cell line by AURKAIP1 polyclonal antibody. Lane 1: AURKAIP1 transfected lysate (21.89kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to AURKAIP1 on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-AURKAIP1 antibody

AKIP may act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.

Product Categories/Family for anti-AURKAIP1 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 187829360
• NCBI GeneID: 54998
• NCBI Accession #: NP_001120702.1
• NCBI GenBank Nucleotide #: NM_001127230.1
• UniProt Accession #: Q9NWT8; Q5TA36; Q8TBD3
• Molecular Weight: 22,354 Da
• NCBI Official Full Name: aurora kinase A-interacting protein
• NCBI Official Synonym Full Names: aurora kinase A interacting protein 1
• NCBI Official Symbol: AURKAIP1
• NCBI Official Synonym Symbols: AIP; AKIP
• NCBI Protein Information: aurora kinase A-interacting protein; AURKA-interacting protein; aurora-A kinase interacting protein
• UniProt Protein Name: Aurora kinase A-interacting protein
• Protein Family: Aurora kinase A-interacting protein
• UniProt Gene Name: AURKAIP1
• UniProt Synonym Gene Names: AIP; AKIP; MRPS38; AURKA-interacting protein; MRP-S38
• UniProt Entry Name: AKIP_HUMAN

Uniprot Description

AKIP: May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 1p36.33

Cellular Component: nucleoplasm; mitochondrion; intracellular membrane-bound organelle; mitochondrial inner membrane; nucleus

Molecular Function: protein binding

Biological Process: mitochondrial translation; positive regulation of proteolysis; organelle organization and biogenesis; negative regulation of mitosis