Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CLIP1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CLIP1 Polyclonal Antibody | anti-CLIP1 antibody

CLIP1 Antibody - C-terminal region

Gene Names
CLIP1; RSN; CLIP; CYLN1; CLIP170; CLIP-170
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CLIP1; Polyclonal Antibody; CLIP1 Antibody - C-terminal region; anti-CLIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCP
Sequence Length
1392
Applicable Applications for anti-CLIP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CLIP1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CLIP1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CLIP1 antibody
The protein encoded by this gene links endocytic vesicles to microtubules. This gene is highly expressed in Reed-Sternberg cells of Hodgkin disease. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CLIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
153 kDa
NCBI Official Full Name
CAP-Gly domain-containing linker protein 1 isoform c
NCBI Official Synonym Full Names
CAP-Gly domain containing linker protein 1
NCBI Official Symbol
CLIP1
NCBI Official Synonym Symbols
RSN; CLIP; CYLN1; CLIP170; CLIP-170
NCBI Protein Information
CAP-Gly domain-containing linker protein 1
UniProt Protein Name
CAP-Gly domain-containing linker protein 1
UniProt Gene Name
CLIP1
UniProt Synonym Gene Names
CYLN1; RSN; CLIP-170
UniProt Entry Name
CLIP1_HUMAN

NCBI Description

The protein encoded by this gene links endocytic vesicles to microtubules. This gene is highly expressed in Reed-Sternberg cells of Hodgkin disease. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

Restin: Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth and microtubule bundling. Links cytoplasmic vesicles to microtubules and thereby plays an important role in intracellular vesicle trafficking. Plays a role macropinocytosis and endosome trafficking. Interacts with MTOR; phosphorylates and regulates CLIP1. Interacts (via CAP-Gly domains) with tubulin. Interacts with SLAIN2. Interacts (via zinc finger) with DCTN1. Interacts with MAPRE1 and MAPRE3. Detected in dendritic cells. Highly expressed in the Reed-Sternberg cells of Hodgkin disease. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 12q24.3

Cellular Component: microtubule cytoskeleton; kinetochore; ruffle; centrosome; microtubule; cytoplasmic vesicle membrane; cytoplasmic microtubule; cytoplasm; intermediate filament; cytosol; endosome

Molecular Function: tubulin binding; microtubule plus-end binding; protein binding; protein homodimerization activity; nucleic acid binding; zinc ion binding; metal ion binding; microtubule binding

Biological Process: mitosis; positive regulation of microtubule polymerization; mitotic cell cycle; microtubule bundle formation

Research Articles on CLIP1

Similar Products

Product Notes

The CLIP1 clip1 (Catalog #AAA3222065) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLIP1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLIP1 clip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMMSEAALNG NGDDLNNYDS DDQEKQSKKK PRLFCDICDC FDLHDTEDCP. It is sometimes possible for the material contained within the vial of "CLIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.