Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AGXT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Rabbit AGXT2 Polyclonal Antibody | anti-AGXT2 antibody

AGXT2 antibody - N-terminal region

Gene Names
AGXT2; AGT2; BAIBA; DAIBAT
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AGXT2; Polyclonal Antibody; AGXT2 antibody - N-terminal region; anti-AGXT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK
Sequence Length
514
Applicable Applications for anti-AGXT2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Horse: 79%; Human: 100%; Mouse: 77%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AGXT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AGXT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-AGXT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-AGXT2 antibody
This is a rabbit polyclonal antibody against AGXT2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.
Product Categories/Family for anti-AGXT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
alanine--glyoxylate aminotransferase 2, mitochondrial isoform a
NCBI Official Synonym Full Names
alanine--glyoxylate aminotransferase 2
NCBI Official Symbol
AGXT2
NCBI Official Synonym Symbols
AGT2; BAIBA; DAIBAT
NCBI Protein Information
alanine--glyoxylate aminotransferase 2, mitochondrial
UniProt Protein Name
Alanine--glyoxylate aminotransferase 2, mitochondrial
UniProt Gene Name
AGXT2
UniProt Synonym Gene Names
AGT2; AGT 2
UniProt Entry Name
AGT2_HUMAN

NCBI Description

The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. It is an important regulator of methylarginines and is involved in the control of blood pressure in kidney. Polymorphisms in this gene affect methylarginine and beta-aminoisobutyrate metabolism, and are associated with carotid atherosclerosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

AGXT2: is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. [provided by RefSeq, Dec 2008]

Protein type: EC 2.6.1.40; Mitochondrial; Amino Acid Metabolism - alanine, aspartate and glutamate; EC 2.6.1.44; Transferase

Chromosomal Location of Human Ortholog: 5p13

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: beta-alanine-pyruvate transaminase activity; alanine-glyoxylate transaminase activity; (R)-3-amino-2-methylpropionate-pyruvate transaminase activity; pyridoxal phosphate binding

Biological Process: pyrimidine nucleoside catabolic process; positive regulation of nitric oxide biosynthetic process; glyoxylate catabolic process; pyrimidine base metabolic process; glyoxylate metabolic process; nucleobase, nucleoside and nucleotide metabolic process; glycine biosynthetic process, by transamination of glyoxylate; L-alanine catabolic process, by transamination

Research Articles on AGXT2

Similar Products

Product Notes

The AGXT2 agxt2 (Catalog #AAA3209259) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGXT2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AGXT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGXT2 agxt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSVTKLSLHT KPRMPPCDFM PERYQSLGYN RVLEIHKEHL SPVVTAYFQK. It is sometimes possible for the material contained within the vial of "AGXT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.