Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (The cryostat section of the sheep hypothalamus was incubated in MBS619483 at the dilution of 1:1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.)

Guinea pig anti-Sheep AgRP Polyclonal Antibody | anti-AGRP antibody

AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)

Gene Names
AGRP; ART; AGRT; ASIP2; MGC118963
Reactivity
Sheep
Applications
Immunohistochemistry
Purity
Serum
Serum
Synonyms
AgRP; Polyclonal Antibody; AgRP (Agouti Related Protein; ART; AGRT; ASIP2; Agouti-related transcript); Anti -AgRP (Agouti Related Protein; anti-AGRP antibody
Ordering
For Research Use Only!
Host
Guinea pig
Reactivity
Sheep
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes AGRP. Species crossreactivity: sheep.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a lyophilized powder. Reconstitute with 50ul sterile 40-50% glycerol, PBS.
Applicable Applications for anti-AGRP antibody
Immunohistochemistry (IHC)
Application Notes
Dilution: Immunohistochemistry (Frozen): 1:1000- :2000
Optimal dilution determined by the researcher.
Immunogen
Synthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein.
Positive Control
Sheep brain (hypothalamus). No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP.

Storage and Stability:
Lyophilized powder may be stored at -20 degree C for short-term only. Reconstitute with sterile 40-50% glycerol, PBS. Aliquot and store at -20 degree C. Reconstituted product is stable for 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Preparation and Storage
4 degree C (-20 degree C Glycerol)

Testing Data

(The cryostat section of the sheep hypothalamus was incubated in MBS619483 at the dilution of 1:1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.)

Testing Data (The cryostat section of the sheep hypothalamus was incubated in MBS619483 at the dilution of 1:1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.)
Related Product Information for anti-AGRP antibody
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.

Applications Suitable for use in Immunohistochemistry. Other applications not tested.
Product Categories/Family for anti-AGRP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
181
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,440 Da
NCBI Official Full Name
agouti-related protein
NCBI Official Synonym Full Names
agouti related protein homolog (mouse)
NCBI Official Symbol
AGRP
NCBI Official Synonym Symbols
ART; AGRT; ASIP2; MGC118963
NCBI Protein Information
agouti-related protein; OTTHUMP00000174803
UniProt Protein Name
Agouti-related protein
Protein Family
UniProt Gene Name
AGRP
UniProt Synonym Gene Names
AGRT; ART
UniProt Entry Name
AGRP_HUMAN

NCBI Description

This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq]

Uniprot Description

AGRP: Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner. Genetic variations in AGRP may be a cause of obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.

Protein type: Secreted; Secreted, signal peptide; Hormone

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: extracellular space; cell soma; Golgi lumen

Molecular Function: neuropeptide hormone activity; receptor binding

Biological Process: maternal process involved in pregnancy; hormone-mediated signaling; neuropeptide signaling pathway; eating behavior; photoperiodism; feeding behavior; adult feeding behavior; response to insulin stimulus

Disease: Obesity

Research Articles on AGRP

Similar Products

Product Notes

The AGRP agrp (Catalog #AAA619483) is an Antibody produced from Guinea pig and is intended for research purposes only. The product is available for immediate purchase. The AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript) reacts with Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AgRP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Dilution: Immunohistochemistry (Frozen): 1:1000- :2000 Optimal dilution determined by the researcher. Researchers should empirically determine the suitability of the AGRP agrp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AgRP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.