Agouti-related protein Recombinant Protein | AGRP recombinant protein

Recombinant Human Agouti-related protein

Cat. Num. AAA967395

• Gene Names: AGRP; ART; AGRT; ASIP2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Agouti-related protein; Recombinant Human Agouti-related protein; AGRP recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 83-132. Partial.
• Sequence: SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for AGRP recombinant protein

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner. 5 Publications

Product Categories/Family for AGRP recombinant protein

Cardiovascular

References

Hypothalamic expression of ART, a novel gene related to agouti, is up-regulated in obese and diabetic mutant mice.Shutter J.R., Graham M., Kinsey A.C., Scully S., Luethy R., Stark K.L.Genes Dev. 11:593-602(1997) Antagonism of central melanocortin receptors in vitro and in vivo by agouti-related protein.Ollmann M.M., Wilson B.D., Yang Y.K., Kerns J.A., Chen Y., Gantz I., Barsh G.S.Science 278:135-138(1997) The gene structure and minimal promoter of the human agouti related protein.Brown A.M., Mayfield D.K., Volaufova J., Argyropoulos G.Gene 277:231-238(2001) Association between an agouti-related protein gene polymorphism and anorexia nervosa.Vink T., Hinney A., van Elburg A.A., van Goozen S.H., Sandkuijl L.A., Sinke R.J., Herpertz-Dahlmann B.M., Hebebrand J., Remschmidt H., van Engeland H., Adan R.A.Mol. Psychiatry 6:325-328(2001) SeattleSNPs variation discovery resource Determination of disulfide structure in agouti-related protein (AGRP) by stepwise reduction and alkylation.Bures E.J., Hui J.O., Young Y., Chow D.T., Katta V., Rohde M.F., Zeni L., Rosenfeld R.D., Stark K.L., Haniu M.Biochemistry 37:12172-12177(1998) Characterization of Agouti-related protein binding to melanocortin receptors.Yang Y.K., Thompson D.A., Dickinson C.J., Wilken J., Barsh G.S., Kent S.B., Gantz I.Mol. Endocrinol. 13:148-155(1999) AgRP(83-132) acts as an inverse agonist on the human-melanocortin-4 receptor.Nijenhuis W.A., Oosterom J., Adan R.A.Mol. Endocrinol. 15:164-171(2001) The natural inverse agonist agouti-related protein induces arrestin-mediated endocytosis of melanocortin-3 and -4 receptors.Breit A., Wolff K., Kalwa H., Jarry H., Buch T., Gudermann T.J. Biol. Chem. 281:37447-37456(2006) NMR structure of a minimized human agouti related protein prepared by total chemical synthesis.Bolin K.A., Anderson D.J., Trulson J.A., Thompson D.A., Wilken J., Kent S.B.H., Gantz I., Millhauser G.L.FEBS Lett. 451:125-131(1999) High-resolution NMR structure of the chemically-synthesized melanocortin receptor binding domain AGRP(87-132) of the agouti-related protein.McNulty J.C., Thompson D.A., Bolin K.A., Wilken J., Barsh G.S., Millhauser G.L.Biochemistry 40:15520-15527(2001) Design, pharmacology, and NMR structure of a minimized cystine knot with agouti-related protein activity.Jackson P.J., McNulty J.C., Yang Y.K., Thompson D.A., Chai B., Gantz I., Barsh G.S., Millhauser G.L.Biochemistry 41:7565-7572(2002) A polymorphism in the human agouti-related protein is associated with late-onset obesity.Argyropoulos G., Rankinen T., Neufeld D.R., Rice T., Province M.A., Leon A.S., Skinner J.S., Wilmore J.H., Rao D.C., Bouchard C.J. Clin. Endocrinol. Metab. 87:4198-4202(2002) Functional analysis of the Ala67Thr polymorphism in agouti related protein associated with anorexia nervosa and leanness.de Rijke C.E., Jackson P.J., Garner K.M., van Rozen R.J., Douglas N.R., Kas M.J., Millhauser G.L., Adan R.A.Biochem. Pharmacol. 70:308-316(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 4501995
• NCBI GeneID: 181
• NCBI Accession #: NP_001129.1
• NCBI GenBank Nucleotide #: NM_001138.1
• UniProt Accession #: O00253; O15459; Q2TBD9
• Molecular Weight: 32.7 kDa
• NCBI Official Full Name: agouti-related protein
• NCBI Official Synonym Full Names: agouti related neuropeptide
• NCBI Official Symbol: AGRP
• NCBI Official Synonym Symbols: ART; AGRT; ASIP2
• NCBI Protein Information: agouti-related protein
• UniProt Protein Name: Agouti-related protein
• Protein Family: Agouti-related protein
• UniProt Gene Name: AGRP
• UniProt Synonym Gene Names: AGRT; ART
• UniProt Entry Name: AGRP_HUMAN

NCBI Description

This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq, Dec 2009]

Uniprot Description

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R (). Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.