Western Blot (WB)
(Western Blot analysis of AGR3 expression in transfected 293T cell line by AGR3 polyclonal antibody. Lane 1: AGR3 transfected lysate (19.2kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human AGR3 Polyclonal Antibody | anti-AGR3 antibody
AGR3 (BCMP11, Anterior Gradient Protein 3 Homolog, Breast Cancer Membrane Protein 11) APC
Gene Names
AGR3; AG3; HAG3; hAG-3; BCMP11; PDIA18
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AGR3; Polyclonal Antibody; AGR3 (BCMP11; Anterior Gradient Protein 3 Homolog; Breast Cancer Membrane Protein 11) APC; anti-AGR3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AGR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-AGR3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AGR3, aa1-166 (NP_789783.1).
Immunogen Sequence
MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of AGR3 expression in transfected 293T cell line by AGR3 polyclonal antibody. Lane 1: AGR3 transfected lysate (19.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of AGR3 expression in transfected 293T cell line by AGR3 polyclonal antibody. Lane 1: AGR3 transfected lysate (19.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AGR3 antibody
AGR3 (Anterior Gradient 3) protein, also known as AG3 (hAG3, HAG3 in human), or BCMP11, is a secreted cytoplasmic protein which is involved in metastasis induction and p53 tumour supressor inhibition. It may serve as molecular marker and potential therapeutic target for hormone-responsive breast tumours. Its Xenopus homolog is associated with anteroposterior fate determination during early development.
Product Categories/Family for anti-AGR3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,171 Da
NCBI Official Full Name
anterior gradient protein 3 homolog
NCBI Official Synonym Full Names
anterior gradient 3 homolog (Xenopus laevis)
NCBI Official Symbol
AGR3
NCBI Official Synonym Symbols
AG3; HAG3; hAG-3; BCMP11; PDIA18
NCBI Protein Information
anterior gradient protein 3 homolog; AG-3; anterior gradient homolog 3; breast cancer membrane protein 11; protein disulfide isomerase family A, member 18
UniProt Protein Name
Anterior gradient protein 3 homolog
Protein Family
UniProt Gene Name
AGR3
UniProt Synonym Gene Names
BCMP11; AG-3; AG3; hAG-3
UniProt Entry Name
AGR3_HUMAN
Uniprot Description
AGR3: Belongs to the AGR family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 7p21.1
Cellular Component: extracellular region
Molecular Function: protein binding
Research Articles on AGR3
Similar Products
Product Notes
The AGR3 agr3 (Catalog #AAA6369045) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGR3 (BCMP11, Anterior Gradient Protein 3 Homolog, Breast Cancer Membrane Protein 11) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AGR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AGR3 agr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AGR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
