Mouse anti-Human IL18RAP Monoclonal Antibody | anti-IL18RAP antibody

IL18RAP (Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, Accessory Protein-like, AcPL, CD218 Antigen-like Family Member B, CDw218b, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7,

Cat. Num. AAA6153059

• Gene Names: IL18RAP; ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL18RAP; Monoclonal Antibody; IL18RAP (Interleukin-18 Receptor Accessory Protein; IL-18 Receptor Accessory Protein; IL-18RAcP; Accessory Protein-like; AcPL; CD218 Antigen-like Family Member B; CDw218b; IL-1R Accessory Protein-like; IL-1RAcPL; Interleukin-1 Receptor 7; IL-1R-7; IL-1R7; ; anti-IL18RAP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G4
• Specificity: Recognizes human IL18RAP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-IL18RAP antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa20-129 from IL18RAP (NP_003844) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IL18RAP is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-IL18RAP antibody

Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK.

Product Categories/Family for anti-IL18RAP antibody

Antibodies; Interleukin

References

1. Gene expression profiling in the synovium identifies a predictive signature of absence of response to adalimumab therapy in rheumatoid arthritis. Badot V, Galant C, Nzeusseu Toukap A, Theate I, Maudoux AL, Van den Eynde BJ, Durez P, Houssiau FA, Lauwerys BR.Arthritis Res Ther. 2009;11(2):R57. Epub 2009 Apr 23. 2. Association study of the IL18RAP locus in three European populations with coeliac disease. Koskinen LL, Einarsdottir E, Dukes E, Heap GA, Dubois P, Korponay-Szabo IR, Kaukinen K, Kurppa K, Ziberna F, Vatta S, Not T, Ventura A, Sistonen P, Adany R, Pocsai Z, Szeles G, Maki M, Kere J, Wijmenga C, van Heel DA, Saavalainen P.Hum Mol Genet. 2009 Mar 15;18(6):1148-55. Epub 2008 Dec 22.

NCBI and Uniprot Product Information

• NCBI GI #: 4504657
• NCBI GeneID: 8807
• NCBI Accession #: NP_003844
• NCBI GenBank Nucleotide #: NM_003853
• UniProt Accession #: O95256; Q2QDE5; Q3KPE7; Q3KPE8; Q53TT4; Q53TU5; B2RPJ3
• Molecular Weight: 65.4kDa (576aa) 70-100KDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: interleukin-18 receptor accessory protein
• NCBI Official Synonym Full Names: interleukin 18 receptor accessory protein
• NCBI Official Symbol: IL18RAP
• NCBI Official Synonym Symbols: ACPL; CD218b; IL-1R7; IL18RB; CDw218b; IL-1R-7; IL-18RAcP; IL-1RAcPL; IL-18Rbeta; IL-18R-beta
• NCBI Protein Information: interleukin-18 receptor accessory protein
• UniProt Protein Name: Interleukin-18 receptor accessory protein
• Protein Family: Interleukin-18 receptor accessory protein
• UniProt Gene Name: IL18RAP
• UniProt Synonym Gene Names: IL1R7; IL-18 receptor accessory protein; IL-18RAcP; AcPL; IL-1RAcPL; IL-1R-7; IL-1R7; IL-18R-beta; IL-18Rbeta
• UniProt Entry Name: I18RA_HUMAN

NCBI Description

The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]

Uniprot Description

IL18RAP: Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex. Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK. Belongs to the interleukin-1 receptor family.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to membrane

Molecular Function: receptor activity

Biological Process: cell surface receptor linked signal transduction; immune response; inflammatory response