Western Blot (WB)
(ORM1 rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in mouse testis.)
Rabbit anti-Human AGP1 Polyclonal Antibody | anti-AGP1 antibody
AGP1 (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, ORM1) APC
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AGP1; Polyclonal Antibody; AGP1 (Alpha-1-acid Glycoprotein 1; AGP 1; Orosomucoid-1; OMD 1; ORM1) APC; anti-AGP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ORM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
201
Applicable Applications for anti-AGP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ORM1, aa1-201 (NP_000598.1).
Immunogen Sequence
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(ORM1 rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in mouse testis.)
Western Blot (WB)
(ORM1 rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in mouse testis.)
Western Blot (WB)
(ORM1 rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in Raw 264.7.)
Western Blot (WB)
(ORM1 rabbit polyclonal antibody. Western Blot analysis of ORM1 expression in Raw 264.7.)
Western Blot (WB)
(Western Blot analysis of ORM1 expression in transfected 293T cell line by ORM1 polyclonal antibody. Lane 1: ORM1 transfected lysate (23.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ORM1 expression in transfected 293T cell line by ORM1 polyclonal antibody. Lane 1: ORM1 transfected lysate (23.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AGP1 antibody
a1-Acid Glycoprotein (AGP; also OMD/Orosomucoid) is a 40-46kD member of the immunocalin subfamily, lipocalin family of molecules. In mouse, circulating AGP is principally the product of hepatocytes that originates from multiple related genes (AGP-1,-2 and-3 in Mus musculus). Circulating AGP-1 and-2 are both 189aa in length, the principal sources of protein, and show 83% aa identity; AGP-3 contributes little to the AGP pool. In mouse blood, AGP is normally 200-400ug/ml. In response to inflammatory mediators (IL-6; IL-1), its concentration will rise 2-10 fold. More importantly, a complex glycosylation pattern will also change, transitioning from modestly branched to highly branched oligosaccharides. This change is reflected in its bioactivity, which has been shown to be a function of carbohydrate branching. AGP is generally considered to be a suppressor of inflammation.
Product Categories/Family for anti-AGP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
orosomucoid 1
Protein Family
Similar Products
Product Notes
The AGP1 (Catalog #AAA6369023) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGP1 (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, ORM1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AGP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AGP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AGP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
