Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Ago2/eIF2C2 expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Ago2/eIF2C2 at 97KD was detected using rabbit anti- Ago2/eIF2C2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit Ago2/eIF2C2 Polyclonal Antibody | anti-AGO2 antibody

Anti-Ago2/eIF2C2 Antibody

Gene Names
AGO2; Q10; EIF2C2
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Ago2/eIF2C2; Polyclonal Antibody; Anti-Ago2/eIF2C2 Antibody; Ago 2; Ago2; Argonaute2; Argonaute-2; Argonaute 2; dAgo2; eIF 2C 2; eIF-2C 2; eIF2C 2; Eif2c2; hAgo2; PAZ Piwi domain protein; PPD; Q10; Slicer protein; Q9UKV8; Protein argonaute-2; argonaute 2; RISC catalytic component; anti-AGO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
825
Applicable Applications for anti-AGO2 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Ago2/eIF2C2 expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Ago2/eIF2C2 at 97KD was detected using rabbit anti- Ago2/eIF2C2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Ago2/eIF2C2 expression in rat brain extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Ago2/eIF2C2 at 97KD was detected using rabbit anti- Ago2/eIF2C2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-AGO2 antibody
Rabbit IgG polyclonal antibody for Protein argonaute-2 (AGO2) detection.
Background: Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: EIF2C2 eukaryotic translation initiation factor 2C, 2".
2. Koesters R, Adams V, Betts D, Moos R, Schmid M, Siermann A, Hassam S, Weitz S, Lichter P, Heitz PU, von Knebel Doeberitz M, Briner J (Dec 1999). "Human eukaryotic initiation factor EIF2C1 gene: cDNA sequence, genomic organization, localization to chromosomal bands 1p34-p35, and expression". Genomics 61 (2): 210-8.
3. Sasaki T, Shiohama A, Minoshima S, Shimizu N (Aug 2003). "Identification of eight members of the Argonaute family in the human genome small star, filled". Genomics 82 (3): 323-30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93,620 Da
NCBI Official Full Name
protein argonaute-2 isoform 2
NCBI Official Synonym Full Names
argonaute 2, RISC catalytic component
NCBI Official Symbol
AGO2
NCBI Official Synonym Symbols
Q10; EIF2C2
NCBI Protein Information
protein argonaute-2
UniProt Protein Name
Protein argonaute-2
Protein Family
UniProt Gene Name
AGO2
UniProt Synonym Gene Names
EIF2C2; Argonaute2; hAgo2; eIF-2C 2; eIF2C 2; PPD
UniProt Entry Name
AGO2_HUMAN

NCBI Description

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

AGO2: the endonuclease in RNA-induced silencing complexes (RISC) that cleaves siRNA/mRNA heteroduplexes bound to RISC. Ago2, along with Dicer and TRBP, are major components of RISC. Interacts with Dicer1 through its Piwi domain. Required for proper fibroblast growth factor signaling during gastrulation. Essential for embryonic development as well as RNA-mediated gene silencing (RNAi).

Protein type: EC 3.1.26.n2; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 8q24

Cellular Component: cytoplasm; cytosol; membrane; mRNA cap complex; nucleoplasm; nucleus; polysome; ribonucleoprotein complex

Molecular Function: double-stranded RNA binding; endoribonuclease activity; miRNA binding; protein binding; protein C-terminus binding; RNA 7-methylguanosine cap binding; single-stranded RNA binding; siRNA binding

Biological Process: miRNA-mediated gene silencing, miRNA loading onto RISC; miRNA-mediated gene silencing, mRNA cleavage; miRNA-mediated gene silencing, negative regulation of translation; miRNA-mediated gene silencing, production of miRNAs; negative regulation of translational initiation; phosphoinositide-mediated signaling; positive regulation of transcription from RNA polymerase II promoter; pre-microRNA processing; RNA interference, siRNA loading onto RISC; RNA secondary structure unwinding; RNA-mediated gene silencing; RNA-mediated posttranscriptional gene silencing; Wnt receptor signaling pathway, calcium modulating pathway

Research Articles on AGO2

Similar Products

Product Notes

The AGO2 ago2 (Catalog #AAA178478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Ago2/eIF2C2 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Ago2/eIF2C2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the AGO2 ago2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ago2/eIF2C2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.