Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HSPA6 is 0.1 ng/ml as a capture antibody.)

Mouse HSPA6 Monoclonal Antibody | anti-HSPA6 antibody

HSPA6 (Heat Shock 70kD Protein 6 (HSP70B')) (PE)

Applications
Western Blot
Purity
Purified
Synonyms
HSPA6; Monoclonal Antibody; HSPA6 (Heat Shock 70kD Protein 6 (HSP70B')) (PE); Heat Shock 70kD Protein 6 (HSP70B'); anti-HSPA6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6H7
Specificity
Recognizes HSPA6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HSPA6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HSPA6 (NP_002146.2, 544aa-643aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HSPA6 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSPA6 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-HSPA6 antibody
Mouse monoclonal antibody raised against a partial recombinant HSPA6.
Product Categories/Family for anti-HSPA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,028 Da
NCBI Official Full Name
heat shock 70 kDa protein 6
NCBI Official Synonym Full Names
heat shock 70kDa protein 6 (HSP70B')
NCBI Official Symbol
HSPA6
NCBI Protein Information
heat shock 70 kDa protein 6; heat shock 70 kDa protein B'; heat shock 70kD protein 6 (HSP70B')
UniProt Protein Name
Heat shock 70 kDa protein 6
Protein Family
UniProt Gene Name
HSPA6
UniProt Synonym Gene Names
HSP70B'
UniProt Entry Name
HSP76_HUMAN

Uniprot Description

HSPA6: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Belongs to the heat shock protein 70 family.

Protein type: Heat shock protein

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: centriole; signalosome; cytoplasm; cytosol

Molecular Function: enzyme binding; heat shock protein binding; unfolded protein binding; ATPase activity, coupled; ATP binding

Biological Process: protein refolding; response to unfolded protein

Research Articles on HSPA6

Similar Products

Product Notes

The HSPA6 hspa6 (Catalog #AAA6187724) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HSPA6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSPA6 hspa6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSPA6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.