Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-AFAP1L2 Polyclonal Antibody)

Rabbit anti-Human AFAP1L2 Polyclonal Antibody | anti-AFAP1L2 antibody

AFAP1L2 Polyclonal Antibody

Gene Names
AFAP1L2; XB130; KIAA1914; CTB-1144G6.4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
AFAP1L2; Polyclonal Antibody; AFAP1L2 Polyclonal Antibody; CTB-1144G6.4; KIAA1914; XB130; actin filament-associated protein 1-like 2; anti-AFAP1L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.47 mg/ml (varies by lot)
Sequence Length
818
Applicable Applications for anti-AFAP1L2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human AFAP1L2 (NP_001001936.1).
Immunogen Sequence
MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKVTINKQQNAESQGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESPEGYYEEAEPYDTSLNEDGEAVSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICAFLWRKKWLGQWAKQLCVIKDNRLLCYKSSKDHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQRFNCQKPDIAEK
Positive Samples
U-87MG, LO2
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-AFAP1L2 Polyclonal Antibody)

Western Blot (WB) (Western blot-AFAP1L2 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 38kDa; 90kDa; 91kDa; 93kDa
Observed: 110kDa
NCBI Official Full Name
actin filament-associated protein 1-like 2 isoform 1
NCBI Official Synonym Full Names
actin filament associated protein 1 like 2
NCBI Official Symbol
AFAP1L2
NCBI Official Synonym Symbols
XB130; KIAA1914; CTB-1144G6.4
NCBI Protein Information
actin filament-associated protein 1-like 2
UniProt Protein Name
Actin filament-associated protein 1-like 2
UniProt Gene Name
AFAP1L2
UniProt Synonym Gene Names
KIAA1914; XB130; AFAP1-like protein 2
UniProt Entry Name
AF1L2_HUMAN

Uniprot Description

AFAP1L2: May play a role in a signaling cascade by enhancing the kinase activity of SRC. Contributes to SRC-regulated transcription activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Activator

Chromosomal Location of Human Ortholog: 10q25.3

Cellular Component: cytoplasm; plasma membrane

Molecular Function: protein tyrosine kinase activator activity; SH2 domain binding; SH3 domain binding

Biological Process: positive regulation of interleukin-8 production; positive regulation of transcription, DNA-dependent; positive regulation of epidermal growth factor receptor signaling pathway; regulation of mitotic cell cycle; regulation of interleukin-6 production; inflammatory response

Research Articles on AFAP1L2

Similar Products

Product Notes

The AFAP1L2 afap1l2 (Catalog #AAA9140610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AFAP1L2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AFAP1L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the AFAP1L2 afap1l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AFAP1L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.