Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged IFIT3 is 0.03ng/ml as a capture antibody.)

Mouse anti-Human IFIT3 Monoclonal Antibody | anti-IFIT3 antibody

IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG

Gene Names
IFIT3; P60; IRG2; IFI60; IFIT4; ISG60; RIG-G; cig41; CIG-49; GARG-49
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFIT3; Monoclonal Antibody; IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3; IFIT-3; CIG49; ISG-60; Interferon-induced 60kD Protein; IFI-60K; Interferon-induced Protein with Tetratricopeptide Repeats 4; IFIT-4; Retinoic Acid-induced Gene G-Protein; P60; RIG-G; CIG; anti-IFIT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C10
Specificity
Recognizes human IFIT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-IFIT3 antibody
ELISA (EIA)
Application Notes
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa392-490 from human IFIT3 (NP_001540.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
STDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IFIT3 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IFIT3 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-IFIT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
interferon-induced protein with tetratricopeptide repeats 3 isoform a
NCBI Official Synonym Full Names
interferon induced protein with tetratricopeptide repeats 3
NCBI Official Symbol
IFIT3
NCBI Official Synonym Symbols
P60; IRG2; IFI60; IFIT4; ISG60; RIG-G; cig41; CIG-49; GARG-49
NCBI Protein Information
interferon-induced protein with tetratricopeptide repeats 3
UniProt Protein Name
Interferon-induced protein with tetratricopeptide repeats 3
UniProt Gene Name
IFIT3
UniProt Synonym Gene Names
CIG-49; IFI60; IFIT4; ISG60; IFIT-3; IFI-60K; IFIT-4; P60; RIG-G
UniProt Entry Name
IFIT3_HUMAN

Uniprot Description

IFIT3: IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS- mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin- dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2. Belongs to the IFIT family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding

Biological Process: negative regulation of cell proliferation; cytokine and chemokine mediated signaling pathway; response to virus; defense response to virus; negative regulation of apoptosis

Research Articles on IFIT3

Similar Products

Product Notes

The IFIT3 ifit3 (Catalog #AAA6158323) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFIT3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFIT3 ifit3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFIT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.