Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADRM1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Rabbit ADRM1 Polyclonal Antibody | anti-ADRM1 antibody

ADRM1 antibody - C-terminal region

Gene Names
ADRM1; ARM1; ARM-1; GP110
Reactivity
Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADRM1; Polyclonal Antibody; ADRM1 antibody - C-terminal region; anti-ADRM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE
Sequence Length
407
Applicable Applications for anti-ADRM1 antibody
Western Blot (WB)
Homology
Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADRM1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRM1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADRM1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlADRM1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: ADRM1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlADRM1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(Host: RabbitTarget Name: ADRM1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRM1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADRM1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRM1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADRM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADRM1Sample Type: Human HelaAntibody Dilution: 1.0ug/mlADRM1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (Host: RabbitTarget Name: ADRM1Sample Type: Human HelaAntibody Dilution: 1.0ug/mlADRM1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB)

(WB Suggested Anti-ADRM1 antibodyTitration: 1 ug/mlPositive Control: HeLa cells and cytosol from male mouse liver)

Western Blot (WB) (WB Suggested Anti-ADRM1 antibodyTitration: 1 ug/mlPositive Control: HeLa cells and cytosol from male mouse liver)
Related Product Information for anti-ADRM1 antibody
This is a rabbit polyclonal antibody against ADRM1. It was validated on Western Blot

Target Description: The protein encoded by this gene is an integral plasma membrane protein which promotes cell adhesion. The encoded protein is thought to undergo O-linked glycosylation. Expression of this gene has been shown to be induced by gamma interferon in some cancer cells. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-ADRM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
proteasomal ubiquitin receptor ADRM1 isoform 1
NCBI Official Synonym Full Names
adhesion regulating molecule 1
NCBI Official Symbol
ADRM1
NCBI Official Synonym Symbols
ARM1; ARM-1; GP110
NCBI Protein Information
proteasomal ubiquitin receptor ADRM1
UniProt Protein Name
Proteasomal ubiquitin receptor ADRM1
UniProt Gene Name
ADRM1
UniProt Synonym Gene Names
GP110; Gp110; ARM-1; hRpn13
UniProt Entry Name
ADRM1_HUMAN

NCBI Description

This gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5. Increased levels of the encoded protein are associated with increased cell adhesion, which is likely an indirect effect of this intracellular protein. Dysregulation of this gene has been implicated in carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

ADRM1: Functions as a proteasomal ubiquitin receptor. Recruits the deubiquitinating enzyme UCHL5 at the 26S proteasome and promotes its activity. Interacts with PSMD1, ubiquitin and UCHL5. Belongs to the ADRM1 family.

Protein type: Proteasome complex; Cell development/differentiation

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: proteasome complex; nucleoplasm; membrane; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; protease binding

Biological Process: RNA elongation from RNA polymerase II promoter; proteasome assembly

Research Articles on ADRM1

Similar Products

Product Notes

The ADRM1 adrm1 (Catalog #AAA3214306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADRM1 antibody - C-terminal region reacts with Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADRM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADRM1 adrm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLGPLMCQFG LPAEAVEAAN KGDVEAFAKA MQNNAKPEQK EGDTKDKKDE. It is sometimes possible for the material contained within the vial of "ADRM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.