Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.54kD).)

Mouse anti-Human FKBP1B Monoclonal Antibody | anti-FKBP1B antibody

FKBP1B (h-FKBP-12, Immunophilin FKBP12.6, 12.6kD FK506-binding Protein, 12.6kD FKBP, FKBP-12.6, Rotamase, FK506-binding Protein 1B, FKBP-1B, Peptidyl-prolyl cis-trans Isomerase FKBP1B, PPIase FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4) APC

Gene Names
FKBP1B; OTK4; FKBP1L; PKBP1L; PPIase; FKBP12.6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FKBP1B; Monoclonal Antibody; FKBP1B (h-FKBP-12; Immunophilin FKBP12.6; 12.6kD FK506-binding Protein; 12.6kD FKBP; FKBP-12.6; Rotamase; FK506-binding Protein 1B; FKBP-1B; Peptidyl-prolyl cis-trans Isomerase FKBP1B; PPIase FKBP1B; FKBP12.6; FKBP1L; FKBP9; OTK4) APC; anti-FKBP1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H5-1B6
Specificity
Recognizes human FKBP1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FKBP1B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-80 from human FKBP1B (AAH02614) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.54kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.54kD).)

Western Blot (WB)

(Western Blot analysis of FKBP1B expression in transfected 293T cell line by FKBP1B monoclonal antibody. Lane 1: FKBP1B transfected lysate (11.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FKBP1B expression in transfected 293T cell line by FKBP1B monoclonal antibody. Lane 1: FKBP1B transfected lysate (11.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FKBP1B antibody
FKBP1B is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. The protein is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle.
Product Categories/Family for anti-FKBP1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
8,802 Da
NCBI Official Full Name
Homo sapiens FK506 binding protein 1B, 12.6 kDa, mRNA
NCBI Official Synonym Full Names
FK506 binding protein 1B
NCBI Official Symbol
FKBP1B
NCBI Official Synonym Symbols
OTK4; FKBP1L; PKBP1L; PPIase; FKBP12.6
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1B

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq, Jul 2008]

Research Articles on FKBP1B

Similar Products

Product Notes

The FKBP1B (Catalog #AAA6136612) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FKBP1B (h-FKBP-12, Immunophilin FKBP12.6, 12.6kD FK506-binding Protein, 12.6kD FKBP, FKBP-12.6, Rotamase, FK506-binding Protein 1B, FKBP-1B, Peptidyl-prolyl cis-trans Isomerase FKBP1B, PPIase FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FKBP1B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FKBP1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.