Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADI1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit ADI1 Polyclonal Antibody | anti-ADI1 antibody

ADI1 Antibody - N-terminal region

Gene Names
ADI1; ARD; APL1; SIPL; mtnD; Fe-ARD; MTCBP1; Ni-ARD; HMFT1638
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADI1; Polyclonal Antibody; ADI1 Antibody - N-terminal region; anti-ADI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKI
Sequence Length
179
Applicable Applications for anti-ADI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADI1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-ADI1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-ADI1 antibody
This is a rabbit polyclonal antibody against ADI1. It was validated on Western Blot

Target Description: This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20.
Product Categories/Family for anti-ADI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase isoform 1
NCBI Official Synonym Full Names
acireductone dioxygenase 1
NCBI Official Symbol
ADI1
NCBI Official Synonym Symbols
ARD; APL1; SIPL; mtnD; Fe-ARD; MTCBP1; Ni-ARD; HMFT1638
NCBI Protein Information
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
UniProt Protein Name
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
UniProt Gene Name
ADI1
UniProt Entry Name
MTND_HUMAN

NCBI Description

This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

ADI1: Catalyzes the formation of formate and 2-keto-4- methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5- methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line. Belongs to the acireductone dioxygenase (ARD) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - cysteine and methionine; EC 1.13.11.54; Oxidoreductase

Chromosomal Location of Human Ortholog: 2p25.3

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: acireductone dioxygenase [iron(II)-requiring] activity; protein binding; iron ion binding; oxidoreductase activity

Biological Process: methionine salvage; sulfur amino acid metabolic process; polyamine metabolic process

Research Articles on ADI1

Similar Products

Product Notes

The ADI1 adi1 (Catalog #AAA3217060) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADI1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ADI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADI1 adi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YMDDAPGDPR QPHRPDPGRP VGLEQLRRLG VLYWKLDADK YENDPELEKI. It is sometimes possible for the material contained within the vial of "ADI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.