Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HERPUD1 monoclonal antibody Western Blot analysis of HERPUD1 expression in HepG2)

Mouse anti-Human HERPUD1 Monoclonal Antibody | anti-HERPUD1 antibody

HERPUD1 (HERP, KIAA0025, MIF1, Homocysteine-responsive Endoplasmic Reticulum-resident Ubiquitin-like Domain Member 1 Protein, Methyl Methanesulfonate (MMF)-inducible Fragment Protein 1) (HRP)

Gene Names
HERPUD1; SUP; HERP; Mif1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HERPUD1; Monoclonal Antibody; HERPUD1 (HERP; KIAA0025; MIF1; Homocysteine-responsive Endoplasmic Reticulum-resident Ubiquitin-like Domain Member 1 Protein; Methyl Methanesulfonate (MMF)-inducible Fragment Protein 1) (HRP); anti-HERPUD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G7
Specificity
Recognizes human HERPUD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2853
Applicable Applications for anti-HERPUD1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa74-180 from HERPUD1 (NP_055500) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HERPUD1 monoclonal antibody Western Blot analysis of HERPUD1 expression in HepG2)

Western Blot (WB) (HERPUD1 monoclonal antibody Western Blot analysis of HERPUD1 expression in HepG2)

Western Blot (WB)

(Western Blot analysis of HERPUD1 expression in transfected 293T cell line by HERPUD1 monoclonal antibody Lane 1: HERPUD1 transfected lysate (44kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HERPUD1 expression in transfected 293T cell line by HERPUD1 monoclonal antibody Lane 1: HERPUD1 transfected lysate (44kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HERPUD1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HERPUD1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of HERPUD1 transfected lysate using HERPUD1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HERPUD1 rabbit polyclonal antibody)

Immunoprecipitation (IP) (Immunoprecipitation of HERPUD1 transfected lysate using HERPUD1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HERPUD1 rabbit polyclonal antibody)

Testing Data

(Detection limit for recombinant GST tagged HERPUD1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HERPUD1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-HERPUD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens homocysteine inducible ER protein with ubiquitin like domain 1 (HERPUD1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
homocysteine inducible ER protein with ubiquitin like domain 1
NCBI Official Symbol
HERPUD1
NCBI Official Synonym Symbols
SUP; HERP; Mif1
NCBI Protein Information
homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
UniProt Protein Name
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
UniProt Gene Name
HERPUD1
UniProt Synonym Gene Names
HERP; KIAA0025; MIF1
UniProt Entry Name
HERP1_HUMAN

NCBI Description

The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response. This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system. This gene may play a role in both UPR and ERAD. Its expression is induced by UPR and it has an ER stress response element in its promoter region while the encoded protein has an N-terminal ubiquitin-like domain which may interact with the ERAD system. This protein has been shown to interact with presenilin proteins and to increase the level of amyloid-beta protein following its overexpression. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq, Jan 2013]

Uniprot Description

HERPUD1: Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Could enhance presenilin-mediated beta-amyloid protein 40 generation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; membrane

Molecular Function: protein binding

Biological Process: endoplasmic reticulum calcium ion homeostasis; response to unfolded protein; retrograde protein transport, ER to cytosol

Research Articles on HERPUD1

Similar Products

Product Notes

The HERPUD1 herpud1 (Catalog #AAA6152865) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HERPUD1 (HERP, KIAA0025, MIF1, Homocysteine-responsive Endoplasmic Reticulum-resident Ubiquitin-like Domain Member 1 Protein, Methyl Methanesulfonate (MMF)-inducible Fragment Protein 1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HERPUD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HERPUD1 herpud1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HERPUD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.