Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ACSL6Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ACSL6 Polyclonal Antibody | anti-ACSL6 antibody

ACSL6 Antibody - middle region

Gene Names
ACSL6; ACS2; FACL6; LACS2; LACS5; LACS 6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ACSL6; Polyclonal Antibody; ACSL6 Antibody - middle region; anti-ACSL6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLT
Sequence Length
167
Applicable Applications for anti-ACSL6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACSL6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ACSL6Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ACSL6Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACSL6 antibody
The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-ACSL6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81 kDa
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 6 isoform b
NCBI Official Synonym Full Names
acyl-CoA synthetase long chain family member 6
NCBI Official Symbol
ACSL6
NCBI Official Synonym Symbols
ACS2; FACL6; LACS2; LACS5; LACS 6
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 6
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 6
UniProt Gene Name
ACSL6
UniProt Synonym Gene Names
ACS2; FACL6; KIAA0837; LACS5; LACS 6
UniProt Entry Name
ACSL6_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Apr 2011]

Uniprot Description

ACSL6: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Plays an important role in fatty acid metabolism in brain and the acyl-CoAs produced may be utilized exclusively for the synthesis of the brain lipid. A chromosomal aberration involving ACSL6 may be a cause of myelodysplastic syndrome with basophilia. Translocation t(5;12)(q31;p13) with ETV6. A chromosomal aberration involving ACSL6 may be a cause of acute myelogenous leukemia with eosinophilia. Translocation t(5;12)(q31;p13) with ETV6. A chromosomal aberration involving ACSL6 may be a cause of acute eosinophilic leukemia (AEL). Translocation t(5;12)(q31;p13) with ETV6. Belongs to the ATP-dependent AMP-binding enzyme family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Ligase; Lipid Metabolism - fatty acid; EC 6.2.1.3

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: peroxisomal membrane; mitochondrial outer membrane; endoplasmic reticulum membrane; membrane; integral to membrane; plasma membrane; nucleus

Molecular Function: enzyme binding; protein homodimerization activity; ATP binding; long-chain-fatty-acid-CoA ligase activity

Biological Process: response to gravity; acyl-CoA metabolic process; cellular response to insulin stimulus; response to steroid hormone stimulus; neuroblast proliferation; response to hypoxia; neuron development; triacylglycerol biosynthetic process; cellular lipid metabolic process; long-chain fatty acid metabolic process; fatty acid transport; response to nutrient; phospholipid biosynthetic process

Research Articles on ACSL6

Similar Products

Product Notes

The ACSL6 acsl6 (Catalog #AAA3220587) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACSL6 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACSL6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACSL6 acsl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCGVVIKSMQ AVEDCGQENH QAPVPPQPDD LSIVCFTSGT TGNPKGAMLT. It is sometimes possible for the material contained within the vial of "ACSL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.