Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACPT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human ACP4 Polyclonal Antibody | anti-ACP4 antibody

ACP4 Antibody - middle region

Gene Names
ACP4; ACPT; AI1J
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACP4; Polyclonal Antibody; ACP4 Antibody - middle region; anti-ACP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND
Sequence Length
426
Applicable Applications for anti-ACP4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACPT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACPT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ACPT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ACP4 antibody
This is a rabbit polyclonal antibody against ACPT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. The protein encoded by this gene has structural similarity to prostatic and lysosomal acid phosphatases. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Product Categories/Family for anti-ACP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
testicular acid phosphatase
NCBI Official Synonym Full Names
acid phosphatase 4
NCBI Official Symbol
ACP4
NCBI Official Synonym Symbols
ACPT; AI1J
NCBI Protein Information
testicular acid phosphatase
UniProt Protein Name
Testicular acid phosphatase
Protein Family
UniProt Gene Name
ACPT
UniProt Entry Name
PPAT_HUMAN

NCBI Description

Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. The protein encoded by this gene has structural similarity to prostatic and lysosomal acid phosphatases. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

ACPT: Dephosphorylates receptor tyrosine-protein kinase erbB-4 and inhibits the ligand-induced proteolytic cleavage. Belongs to the histidine acid phosphatase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cofactor and Vitamin Metabolism - riboflavin; EC 3.1.3.2; Membrane protein, integral; Phosphatase (non-protein); Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to membrane

Molecular Function: acid phosphatase activity

Biological Process: dephosphorylation

Research Articles on ACP4

Similar Products

Product Notes

The ACP4 acpt (Catalog #AAA3209816) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACP4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACP4 acpt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLLALQGALG LYDGHTPPYA ACLGFEFRKH LGNPAKDGGN VTVSLFYRND. It is sometimes possible for the material contained within the vial of "ACP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.