Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SMPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit SMPD1 Polyclonal Antibody | anti-SMPD1 antibody

SMPD1 antibody - middle region

Gene Names
SMPD1; ASM; NPD; ASMASE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMPD1; Polyclonal Antibody; SMPD1 antibody - middle region; anti-SMPD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV
Sequence Length
631
Applicable Applications for anti-SMPD1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMPD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SMPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-SMPD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Related Product Information for anti-SMPD1 antibody
This is a rabbit polyclonal antibody against SMPD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
sphingomyelin phosphodiesterase isoform 1
NCBI Official Synonym Full Names
sphingomyelin phosphodiesterase 1
NCBI Official Symbol
SMPD1
NCBI Official Synonym Symbols
ASM; NPD; ASMASE
NCBI Protein Information
sphingomyelin phosphodiesterase
UniProt Protein Name
Sphingomyelin phosphodiesterase
UniProt Gene Name
SMPD1
UniProt Synonym Gene Names
ASM; aSMase
UniProt Entry Name
ASM_HUMAN

NCBI Description

The protein encoded by this gene is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB). Multiple transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010]

Uniprot Description

SMPD1: Converts sphingomyelin to ceramide. Also has phospholipase C activities toward 1,2-diacylglycerolphosphocholine and 1,2-diacylglycerolphosphoglycerol. Isoform 2 and isoform 3 have lost catalytic activity. Monomer. Belongs to the acid sphingomyelinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - sphingolipid; EC 3.1.4.12; Phosphodiesterase

Chromosomal Location of Human Ortholog: 11p15.4-p15.1

Cellular Component: extracellular space; lysosomal lumen; lysosome; plasma membrane; endosome; lamellar body

Molecular Function: protein binding; sphingomyelin phosphodiesterase activity; hydrolase activity, acting on glycosyl bonds

Biological Process: response to drug; negative regulation of MAP kinase activity; nervous system development; sphingomyelin metabolic process; sphingolipid metabolic process; positive regulation of apoptosis; ceramide biosynthetic process; glycosphingolipid metabolic process; sphingomyelin catabolic process; response to cocaine; signal transduction; positive regulation of protein amino acid dephosphorylation

Disease: Niemann-pick Disease, Type B; Niemann-pick Disease, Type A

Research Articles on SMPD1

Similar Products

Product Notes

The SMPD1 smpd1 (Catalog #AAA3202667) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMPD1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SMPD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMPD1 smpd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: INSTDPAGQL QWLVGELQAA EDRGDKVHII GHIPPGHCLK SWSWNYYRIV. It is sometimes possible for the material contained within the vial of "SMPD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.