Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACD Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysate)

Rabbit ACD Polyclonal Antibody | anti-ACD antibody

ACD antibody - middle region

Gene Names
ACD; PIP1; PTOP; TPP1; TINT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACD; Polyclonal Antibody; ACD antibody - middle region; anti-ACD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ
Sequence Length
544
Applicable Applications for anti-ACD antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACD Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-ACD Antibody Titration: 0.2-1 ug/mlPositive Control: NCI-H226 cell lysate)
Related Product Information for anti-ACD antibody
This is a rabbit polyclonal antibody against ACD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other comp
Product Categories/Family for anti-ACD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
adrenocortical dysplasia protein homolog isoform 1
NCBI Official Synonym Full Names
ACD shelterin complex subunit and telomerase recruitment factor
NCBI Official Symbol
ACD
NCBI Official Synonym Symbols
PIP1; PTOP; TPP1; TINT1
NCBI Protein Information
adrenocortical dysplasia protein homolog
UniProt Protein Name
Adrenocortical dysplasia protein homolog
Protein Family
UniProt Gene Name
ACD
UniProt Synonym Gene Names
PIP1; PTOP; TINT1; TPP1
UniProt Entry Name
ACD_HUMAN

NCBI Description

This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I. [provided by RefSeq, Jul 2008]

Uniprot Description

ACD: Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Promotes binding of POT1 to single-stranded telomeric DNA. Modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomere elongation by increasing telomerase processivity. Plays a role in shelterin complex assembly. May play a role in organogenesis. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nucleoplasm; chromosome, telomeric region; nuclear telomere cap complex; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: intracellular protein transport; telomere assembly; telomere capping; segmentation; positive regulation of telomerase activity; negative regulation of telomere maintenance via telomerase; skeletal development; telomere maintenance; urogenital system development; embryonic limb morphogenesis; protection from non-homologous end joining at telomere

Research Articles on ACD

Similar Products

Product Notes

The ACD acd (Catalog #AAA3213809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACD antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACD acd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNRPPFPRTG ATRGAQEPCS VWEPPKRHRD GSAFQYEYEP PCTSLCARVQ. It is sometimes possible for the material contained within the vial of "ACD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.