Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '13507'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.05 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '13507' and pd.language_id = 1
Query
Database
1.45 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '13507'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.73 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '13507'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '13507' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '13507'
⇄⧉products_description => string (1534) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti- E-Selectin polyclonal antibody was pre-coated onto 96-well plates. And the biotin conjugated anti- E-Selectin polyclonal antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and wash with wash buffer. Avidin-Biotin-Peroxidase Complex was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the E-Selectin amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of E-Selectin can be calculated.<br><br>Background/Introduction: E-selectin, also known as CD62 antigen-like family member E (CD62E), endothelial-leukocyte adhesion molecule 1 (ELAM-1), or leukocyte-endothelial cell adhesion molecule 2 (LECAM2), is a cell adhesion molecule expressed only on endothelial cells activated by cytokines. The ELAM gene is present in single copy in the human genome and contains 14 exons spanning about 13 kb of DNA. E-selectin mediates the adhesion of tumor cells to endothelial cells, by binding to E-selectin ligands expressed by neutrophils, monocytes, eosinophils, memory-effector T-like lymphocytes, natural killer cells or cancer cells.
⇄⧉products_description => string (1534) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value->a['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti- E-Selectin polyclonal antibody was pre-coated onto 96-well plates. And the biotin conjugated anti- E-Selectin polyclonal antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and wash with wash buffer. Avidin-Biotin-Peroxidase Complex was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the E-Selectin amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of E-Selectin can be calculated.<br><br>Background/Introduction: E-selectin, also known as CD62 antigen-like family member E (CD62E), endothelial-leukocyte adhesion molecule 1 (ELAM-1), or leukocyte-endothelial cell adhesion molecule 2 (LECAM2), is a cell adhesion molecule expressed only on endothelial cells activated by cytokines. The ELAM gene is present in single copy in the human genome and contains 14 exons spanning about 13 kb of DNA. E-selectin mediates the adhesion of tumor cells to endothelial cells, by binding to E-selectin ligands expressed by neutrophils, monocytes, eosinophils, memory-effector T-like lymphocytes, natural killer cells or cancer cells.
⇄⧉products_description => string (1534) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value->d['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Anti- E-Selectin polyclonal antibody was pre-coated onto 96-well plates. And the biotin conjugated anti- E-Selectin polyclonal antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and wash with wash buffer. Avidin-Biotin-Peroxidase Complex was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the E-Selectin amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of E-Selectin can be calculated.<br><br>Background/Introduction: E-selectin, also known as CD62 antigen-like family member E (CD62E), endothelial-leukocyte adhesion molecule 1 (ELAM-1), or leukocyte-endothelial cell adhesion molecule 2 (LECAM2), is a cell adhesion molecule expressed only on endothelial cells activated by cytokines. The ELAM gene is present in single copy in the human genome and contains 14 exons spanning about 13 kb of DNA. E-selectin mediates the adhesion of tumor cells to endothelial cells, by binding to E-selectin ligands expressed by neutrophils, monocytes, eosinophils, memory-effector T-like lymphocytes, natural killer cells or cancer cells.
⇄products_name_oem => string (36) "Human Carbonic Anhydrase I ELISA Kit"
$value[0]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[0]['_source']['products_name_syn']
⇄products_gene_name => string (3) "CA1"
$value[0]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[0]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1317) "Intended Uses: This CA ELISA kit is a 1.5 hour solid-phase ELISA designed fo...
$value[0]['_source']['products_description']
Intended Uses: This CA ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Porcine CA. This ELISA kit for research use only!<br><br>Principle of the Assay: CA ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-CA antibody and an CA-HRP conjugate. The assay sample and buffer are incubated together with CA-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the CA concentration since CA from samples and CA-HRP conjugate compete for the anti-CA antibody binding site. Since the number of sites is limited, as more sites are occupied by CA from the sample, fewer sites are left to bind CA-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The CA concentration in each sample is interpolated from this standard curve.
⇄products_references => string (3) "N/A"
$value[0]['_source']['products_references']
⇄⧉products_related_diseases => string (260) "Central Nervous System Diseases||6247!!Brain Ischemia||3406!!Cardiovascular ...
$value[0]['_source']['products_related_diseases']
Central Nervous System Diseases||6247!!Brain Ischemia||3406!!Cardiovascular Diseases||3279!!Mental Disorders||1626!!Memory Disorders||923!!Learning Disorders||729!!Nerve Degeneration||717!!Neurobehavioral Manifestations||696!!Brain Injuries||403!!Necrosis||391
carbonic anhydrase 1; carbonic anhydrase B; carbonate dehydratase I; epididymis secretory protein Li 11
⇄ncbi_chrom_loc => string (3) "N/A"
$value[0]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "759"
$value[0]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "28,870 Da"
$value[0]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (397) "C-MYB Transcription Factor Network Pathway||138073!!Erythrocytes Take Up Car...
$value[0]['_source']['ncbi_pathways']
C-MYB Transcription Factor Network Pathway||138073!!Erythrocytes Take Up Carbon Dioxide And Release Oxygen Pathway||645347!!Erythrocytes Take Up Oxygen And Release Carbon Dioxide Pathway||645348!!Metabolism Pathway||477135!!Nitrogen Metabolism Pathway||83025!!Nitrogen Metabolism Pathway||416!!O2/CO2 Exchange In Erythrocytes Pathway||645346!!Reversible Hydration Of Carbon Dioxide Pathway||645352
⇄⧉search_terms => string (407) "aaa16572 human typical testing data standard curve for reference only aaa165...
$value[0]['_source']['search_terms']
aaa16572 human typical testing data standard curve for reference only aaa16572_sc elisa kit carbonic anhydrase i ca1 protein cab ca car1 hel s 11 1 b carbonate dehydratase epididymis secretory li 28,870 da cah1_human 20380766 aah27890.1 p00915 114800 samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive sensitivity 1.0 pg ml s11 sensitivity1.0
⇄⧉products_description => string (1330) "Intended Uses: This CA7 ELISA kit is a 1.5 hour solid-phase ELISA designed f...
$value[1]['_source']['products_description']
Intended Uses: This CA7 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Porcine CA7. This ELISA kit for research use only!<br><br>Principle of the Assay||CA7 ELISA kit applies the competitive enzyme immunoassay technique utilizing a monoclonal anti-CA7 antibody and an CA7-HRP conjugate. The assay sample and buffer are incubated together with CA7-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the CA7 concentration since CA7 from samples and CA7-HRP conjugate compete for the anti-CA7 antibody binding site. Since the number of sites is limited, as more sites are occupied by CA7 from the sample, fewer sites are left to bind CA7-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The CA7 concentration in each sample is interpolated from this standard curve.
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of C...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of CA2. No significant cross-reactivity or interference between CA2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (339) "For unopened kits: All the reagents should be kept at 4 degree C upon receip...
$value[2]['_source']['storage_stability']
For unopened kits: All the reagents should be kept at 4 degree C upon receipt.<br>For opened kits: Once the kit is opened, the remaining reagents still need to be stored according to the above storage conditions. In addition, return the unused wells to the foil pouch containing the desiccant pack and reseal along entire edge of zip-seal.
⇄⧉etc_term1 => string (142) "Samples||Serum, plasma or other biological fluids!!Assay Type||Quantitative ...
$value[2]['_source']['etc_term1']
Samples||Serum, plasma or other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||3.12-200ng/mL!!Sensitivity||< 1.22ng/mL
⇄⧉etc_term2 => string (412) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level CA2 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level CA2 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄products_price => string (6) "0.0000"
$value[2]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[2]['_source']['products_weight']
⇄products_status => boolean true
$value[2]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[2]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "450"
$value[2]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[2]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[2]['_source']['language_id']
⇄products_name => string (27) "Carbonic Anhydrase II (CA2)"
⇄⧉products_description => string (987) "Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro qua...
$value[2]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro quantitative measurement of CA2 in monkey serum, plasma or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to CA2. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific to CA2. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain CA2, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of CA2 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (239) "Cardiovascular Diseases||7076!!Nervous System Diseases||4923!!Heart Diseases...
$value[2]['_source']['products_related_diseases']
Cardiovascular Diseases||7076!!Nervous System Diseases||4923!!Heart Diseases||4264!!Disease Models, Animal||2459!!Hypertension||2364!!Inflammation||1454!!Necrosis||1428!!Hypertrophy||1247!!Kidney Diseases||816!!Neoplasms, Experimental||778
⇄⧉search_terms => string (681) "aaa14060 simian this assay has high sensitivity and excellent specificity fo...
$value[2]['_source']['search_terms']
aaa14060 simian this assay has high sensitivity and excellent specificity for detection of ca2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa14060_sc rtu elisa kit carbonic anhydrase ii monkey ca caii car2 cac carbonate dehydratase c 2 16,301 da 306482615 np_001182346.1 nm_001195417.1 q6uir8 samples serum plasma other biological fluids type quantitative sandwich range 3.12 200ng ml < 1.22ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv<10 inter assays different plates 8 replicates in each cv = sd meanx100 cv<12 c2 an3 tested20 plates8
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of C...
$value[3]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of CA2. No significant cross-reactivity or interference between CA2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[3]['_source']['purity']
⇄form => string (3) "N/A"
$value[3]['_source']['form']
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (339) "For unopened kits: All the reagents should be kept at 4 degree C upon receip...
$value[3]['_source']['storage_stability']
For unopened kits: All the reagents should be kept at 4 degree C upon receipt.<br>For opened kits: Once the kit is opened, the remaining reagents still need to be stored according to the above storage conditions. In addition, return the unused wells to the foil pouch containing the desiccant pack and reseal along entire edge of zip-seal.
Samples||Serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||3.12-200ng/mL!!Sensitivity||< 1.34ng/mL
⇄⧉etc_term2 => string (412) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[3]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level CA2 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level CA2 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄products_price => string (6) "0.0000"
$value[3]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[3]['_source']['products_weight']
⇄products_status => boolean true
$value[3]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[3]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "450"
$value[3]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[3]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[3]['_source']['language_id']
⇄products_name => string (27) "Carbonic Anhydrase II (CA2)"
⇄⧉products_description => string (1045) "Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro qua...
$value[3]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro quantitative measurement of CA2 in human serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to CA2. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific to CA2. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain CA2, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of CA2 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Cardiovascular Diseases||6805!!Nervous System Diseases||4690!!Heart Diseases...
$value[3]['_source']['products_related_diseases']
Cardiovascular Diseases||6805!!Nervous System Diseases||4690!!Heart Diseases||4084!!Disease Models, Animal||2298!!Hypertension||2297!!Necrosis||1385!!Inflammation||1384!!Hypertrophy||1213!!Kidney Diseases||787!!Fibrosis||606
⇄⧉search_terms => string (702) "aaa14059 human this assay has high sensitivity and excellent specificity for...
$value[3]['_source']['search_terms']
aaa14059 human this assay has high sensitivity and excellent specificity for detection of ca2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa14059_sc rtu elisa kit carbonic anhydrase ii ca caii car2 cac carbonate dehydratase c 2 isoform 1 hel 76 s 282 29,246 da 4557395 np_000058.1 p00918 nm_000067.2 q6fi12 q96et9 b2r7g8 259730 samples serum plasma tissue homogenates cell lysates culture supernates other biological fluids type quantitative sandwich range 3.12 200ng ml < 1.34ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv c2 isoform1 hel76 s282 an3 tested20
⇄⧉specificity => string (373) "This assay has high sensitivity and excellent specificity for detection of C...
$value[4]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of CA9. No significant cross-reactivity or interference between CA9 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between CA9 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[4]['_source']['purity']
⇄form => string (3) "N/A"
$value[4]['_source']['form']
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1371) "Intended Uses: This CA9 ELISA kit is a 1.5 hour solid-phase ELISA designed f...
$value[4]['_source']['products_description']
Intended Uses: This CA9 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Canine CA9. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: CA9 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-CA9 antibody and an CA9-HRP conjugate. The assay sample and buffer are incubated together with CA9-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the CA9 concentration since CA9 from samples and CA9-HRP conjugate compete for the anti-CA9 antibody binding site. Since the number of sites is limited, as more sites are occupied by CA9 from the sample, fewer sites are left to bind CA9-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The CA9 concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (740) "aaa27170 canine this assay has high sensitivity and excellent specificity fo...
$value[4]['_source']['search_terms']
aaa27170 canine this assay has high sensitivity and excellent specificity for detection of ca9 no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa27170_sc elisa kit carbonic anhydrase 9 ix mn caix pmw1 ca p54 58n membrane antigen dehydratase carbonate rcc associated g250 protein renal cell carcinoma 49,698 da cah9_human 169636420 np_001207.2 q16790 nm_001216.2 q5t4r1 603179 cardiovascular samples serum plasma culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 pg ml anhydrase9 competitive1.0
⇄⧉storage_stability => string (202) "Store at -20 degree C for one year. After reconstitution, at 4 degree C for ...
$value[5]['_source']['storage_stability']
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
⇄⧉app_tested => string (138) "Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistr...
$value[5]['_source']['app_tested']
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM)
FCM (Flow Cytometry)||Figure 7. Flow Cytometry analysis of CACO-2 cells using anti-Carbonic Anhydrase 13/CA13 antibody (AAA19326).<br>Overlay histogram showing CACO-2 cells stained with AAA19326 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Carbonic Anhydrase 13/CA13 Antibody (AAA19326, 1μg/1x10<sup>6</sup> cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10<sup>6</sup> cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10<sup>6</sup>) used under the same conditions. Unlabelled sample (Red line) was also used as a control.||AAA19326_FCM7.png!!IF (Immunofluorescence)||Figure 6. IF analysis of Carbonic Anhydrase 13/CA13 using anti- Carbonic Anhydrase 13/CA13 antibody (AAA19326).<br>Carbonic Anhydrase 13/CA13 was detected in immunocytochemical section of Hep cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti- Carbonic Anhydrase 13/CA13 Antibody (AAA19326) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.||AAA19326_IF6.jpg!!IHC (Immunohistochemistry)||Figure 5. IHC analysis of Carbonic Anhydrase 13/CA13 using anti-Carbonic Anhydrase 13/CA13 antibody (AAA19326).<br>Carbonic Anhydrase 13/CA13 was detected in paraffin-embedded section of human ovarian cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Carbonic Anhydrase 13/CA13 Antibody (AAA19326) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19326_IHC5.jpg!!IHC (Immunohistochemistry)||Figure 4. IHC analysis of Carbonic Anhydrase 13/CA13 using anti-Carbonic Anhydrase 13/CA13 antibody (AAA19326).<br>Carbonic Anhydrase 13/CA13 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Carbonic Anhydrase 13/CA13 Antibody (AAA19326) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19326_IHC4.jpg!!IHC (Immunohistochemistry)||Figure 3. IHC analysis of Carbonic Anhydrase 13/CA13 using anti-Carbonic Anhydrase 13/CA13 antibody (AAA19326).<br>Carbonic Anhydrase 13/CA13 was detected in paraffin-embedded section of human melanoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Carbonic Anhydrase 13/CA13 Antibody (AAA19326) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19326_IHC3.jpg!!IHC (Immunohistochemistry)||Figure 2. IHC analysis of Carbonic Anhydrase 13/CA13 using anti-Carbonic Anhydrase 13/CA13 antibody (AAA19326).<br>Carbonic Anhydrase 13/CA13 was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Carbonic Anhydrase 13/CA13 Antibody (AAA19326) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.||AAA19326_IHC2.jpg!!WB (Western Blot)||Figure 1. Western blot analysis of Carbonic Anhydrase 13/CA13 using anti-Carbonic Anhydrase 13/CA13 antibody (AAA19326).<br>Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.<br>Lane 1: human HepG2 whole cell lysates<br>Lane 2: human CACO-2 whole cell lysates<br>Lane 3: human U87 whole cell lysates<br>Lane 4: human K562 whole cell lysates<br>Lane 5: human Hela whole cell lysates<br>Lane 6: rat intestines tissue lysates<br>Lane 7: mouse NTH/3T3 whole cell lysates.<br>After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-Carbonic Anhydrase 13/CA13 antigen affinity purified polyclonal antibody (Catalog # AAA19326) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for Carbonic Anhydrase 13/CA13 at approximately 29KD. The expected band size for Carbonic Anhydrase 13/CA13 is at 29KD.||AAA19326_WB.jpg
⇄⧉etc_term1 => string (204) "Immunogen||A synthetic peptide corresponding to a sequence of human Carbonic...
$value[5]['_source']['etc_term1']
Immunogen||A synthetic peptide corresponding to a sequence of human Carbonic Anhydrase 13/CA13 (RLSWGYREHNGPIHWKEFFP).!!Reconstitution||Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems||Recommended Detection Systems||Lab recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P) and ICC.
⇄⧉products_description => string (288) "Carbonic anhydrase 13 is a protein that in humans is encoded by the CA13 gen...
$value[5]['_source']['products_description']
Carbonic anhydrase 13 is a protein that in humans is encoded by the CA13 gene. Carbonic anhydrases (CAs) are a family of zinc metalloenzymes that catalyze the interconversion between carbon dioxide and water and the dissociated ions of carbonic acid (i. e. bicarbonate and hydrogen ions).
⇄⧉products_references => string (289) "1. Lehtonen, J., Shen, B., Vihinen, M., Casini, A., Scozzafava, A., Supuran,...
$value[5]['_source']['products_references']
1. Lehtonen, J., Shen, B., Vihinen, M., Casini, A., Scozzafava, A., Supuran, C. T., Parkkila, A. -K., Saarnio, J., Kivela, A. J., Waheed, A., Sly, W. S., Parkkila, S. Characterization of CA XIII, a novel member of the carbonic anhydrase isozyme family. J. Biol. Chem. 279: 2719-2727, 2004.
⇄⧉products_related_diseases => string (137) "Immune System Diseases||4!!IMMUNE SUPPRESSION||2!!Central Nervous System Inf...
$value[5]['_source']['products_related_diseases']
Immune System Diseases||4!!IMMUNE SUPPRESSION||2!!Central Nervous System Infections||2!!Hemostatic Disorders||2!!Graft vs Host Disease||1
⇄⧉search_terms => string (2063) "aaa19326 rabbit human mouse rat polyclonal igg immunogen affinity purified l...
$value[5]['_source']['search_terms']
aaa19326 rabbit human mouse rat polyclonal igg immunogen affinity purified lyophilized each vial contains 4mg trehalose 0.9mg nacl 0.2mg na2hpo4 0.01mg nan3 antibody for carbonic anhydrase 13 ca13 detection western blot wb immunohistochemistry paraffin ihc p immunocytochemistry icc immunofluorescence if flow cytometry fc facs fcm 0.25 0.5ug ml|human rat| 2 5ug ml|human| 1 3ug 1x106 cells|human| figure analysis of using anti electrophoresis was performed on a 5 20 sds page gel at 70v stacking 90v resolving 3 hours the sample well lane loaded with 50ug under reducing conditions hepg2 whole cell lysates caco u87 4 k562 hela 6 intestines tissue 7 nth 3t3 after proteins were transferred to nitrocellulose membrane 150ma 50 90 minutes blocked non fat milk tbs hour rt incubated antigen catalog # 0 &mu g ml overnight degree c then washed tween times and probed goat hrp secondary dilution 1:5000 signal is developed an enhanced chemiluminescent ecl kit mbs176460 tanon 5200 system specific band detected approximately 29kd expected size aaa19326_wb in embedded section liver cancer heat mediated retrieval edta buffer ph8 epitope solution 10 serum 2&mu biotinylated used as 30 37 strepavidin biotin complex sabc mbs176451 dab chromogen aaa19326_ihc2 melanoma aaa19326_ihc3 placenta aaa19326_ihc4 ovarian aaa19326_ihc5 immunocytochemical hep cells enzyme reagent mbs176582 15 mins 5&mu dylight® 488 conjugated 1:100 counterstained dapi visualize fluorescence microscope filter sets appropriate label aaa19326_if6 overlay histogram showing stained blue line normal 1&mu min 10&mu isotype control green same unlabelled red also aaa19326_fc7 carbonate dehydratase xiii ca caxiii 29,443 da cah13_human 38348436 np_940986.1 q8n1q1 nm_198584.2 611436 synthetic peptide corresponding sequence rlswgyrehngpihwkeffp reconstitution add 0.2ml distilled water will yield concentration 500ug recommended systems lab recommends super vision assay mbs176453 anhydrase13 rat|2 ml|human|1 a5 resolving3 u874 hela6 tissue7 150ma50 #0 solution10 as30 mbs17658215 dylight®488
⇄⧉products_description => string (765) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[6]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antigen Sandwich ELISA technique. The pre-coated antigen is a related-Human ICA antigen, while the detection antigen is another antigen. Samples are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[6]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[6]['_source']['products_categories']
⇄ncbi_full_name => string (31) "inhibitor of carbonic anhydrase"
HIF-1 Signaling Pathway||695223!!Mineral Absorption Pathway||212238!!Mineral Absorption Pathway||212220!!XPodNet - Protein-protein Interactions In The Podocyte Expanded By STRING Pathway||755427
⇄sp_protein_name => string (31) "Inhibitor of carbonic anhydrase"
$value[6]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[6]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "Ica"
$value[6]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[6]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (9) "ICA_MOUSE"
$value[6]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[6]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[6]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[6]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[6]['_source']['products_viewed']
⇄⧉search_terms => string (505) "aaa13025 human no cross reaction with other factors typical testing data sta...
$value[6]['_source']['search_terms']
aaa13025 human no cross reaction with other factors typical testing data standard curve for reference only aaa13025_td elisa kit anti islet cell antibodies ica inhibitor of carbonic anhydrase riken cdna 1300017j02 gene 1300017j02rik mica 76,766 da ica_mouse 21313642 np_082194.1 q9dbd0 nm_027918.2 samples serum plasma or culture supernatant and organizations assay type quantitative sandwich detection range 100 ng ml 1.56 sensitivity 0.5 intra precision <= 8 inter 12 range100 sensitivity0.5 <=8 inter12
⇄specificity => string (21) "Recognizes human CA1."
$value[7]['_source']['specificity']
⇄purity => string (8) "Purified"
$value[7]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[7]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[7]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
$value[7]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[7]['_source']['app_notes']
⇄⧉testing_protocols => string (824) "WB (Western Blot)||CA1 monoclonal antibody, Western Blot analysis of CA1 exp...
$value[7]['_source']['testing_protocols']
WB (Western Blot)||CA1 monoclonal antibody, Western Blot analysis of CA1 expression in HeLa.||AAA24742_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged CA1 is ~0.03ng/ml as a capture antibody.||AAA24742_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of CA1 transfected lysate using 124177 and Protein A Magnetic Bead and immunoblotted with CA1 rabbit polyclonal antibody.||AAA24742_IP4.jpg!!WB (Western Blot)||Western Blot analysis of CA1 expression in transfected 293T cell line using 124177. Lane 1: CA1 transfected lysate (28.9kD). Lane 2: Non-transfected lysate.||AAA24742_WB3.jpg!!WB (Western Blot)||Western Blot analysis of CA1 expression in human spleen using 124177||AAA24742_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (54.45kD), using 124177.||AAA24742_WB.jpg
⇄⧉etc_term1 => string (442) "Immunogen||Full length recombinant protein corresponding to aa1-261 from hum...
$value[7]['_source']['etc_term1']
Immunogen||Full length recombinant protein corresponding to aa1-261 from human CA1 (AAH27890) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF!!Conjugate||Biotin
CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (Biotin)
⇄products_name_syn => string (3) "N/A"
$value[7]['_source']['products_name_syn']
⇄products_gene_name => string (3) "CA1"
$value[7]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[7]['_source']['products_gene_name_syn']
⇄⧉products_description => string (572) "Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that cat...
$value[7]['_source']['products_description']
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it is a cytosolic protein which is found at the highest level in erythrocytes.
⇄products_references => string (3) "N/A"
$value[7]['_source']['products_references']
⇄⧉products_related_diseases => string (262) "Central Nervous System Diseases||5911!!Brain Ischemia||3257!!Cardiovascular ...
$value[7]['_source']['products_related_diseases']
Central Nervous System Diseases||5911!!Brain Ischemia||3257!!Cardiovascular Diseases||3134!!Memory Disorders||795!!Nerve Degeneration||698!!Neurobehavioral Manifestations||636!!Learning Disorders||616!!Brain Injuries||377!!Necrosis||362!!Cognition Disorders||311
C-MYB Transcription Factor Network Pathway||138073!!Metabolism Pathway||477135!!O2/CO2 Exchange In Erythrocytes Pathway||645346!!Reversible Hydration Of Carbon Dioxide Pathway||645352!!Uptake Of Carbon Dioxide And Release Of Oxygen By Erythrocytes Pathway||645347!!Uptake Of Oxygen And Release Of Carbon Dioxide By Erythrocytes Pathway||645348
⇄sp_protein_name => string (3) "N/A"
$value[7]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[7]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[7]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[7]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[7]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[7]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[7]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[7]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[7]['_source']['products_viewed']
⇄⧉search_terms => string (1104) "aaa24742 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in ...
$value[7]['_source']['search_terms']
aaa24742 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes ca1 elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 54.45kd using 124177 aaa24742_wb analysis of expression spleen aaa24742_wb2 transfected 293t cell line lane 1 lysate 28.9kd 2 non aaa24742_wb3 and protein magnetic bead immunoblotted rabbit polyclonal aaa24742_ip4 testing data limit for recombinant gst tagged is ~0.03ng ml capture aaa24742_td5 hela aaa24742_wb6 carbonic anhydrase i ca carbonate dehydratase b cab homo sapiens mrna car1 hel s 11 28,870 da 20380765 bc027890 aah27890 p00915 antibodies enzymes full length corresponding to aa1 261 from tag mw the alone 26kd sequence maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhnnrptqplkgrtvrasf conjugate ph7.2 lane1 28.9kd2 s11 aa1261
⇄specificity => string (21) "Recognizes human CA1."
$value[8]['_source']['specificity']
⇄purity => string (8) "Purified"
$value[8]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[8]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[8]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
$value[8]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[8]['_source']['app_notes']
⇄testing_protocols => string (3) "N/A"
$value[8]['_source']['testing_protocols']
⇄⧉etc_term1 => string (439) "Immunogen||Full length recombinant protein corresponding to aa1-261 from hum...
$value[8]['_source']['etc_term1']
Immunogen||Full length recombinant protein corresponding to aa1-261 from human CA1 (AAH27890) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF!!Conjugate||APC
CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) APC
⇄products_name_syn => string (3) "N/A"
$value[8]['_source']['products_name_syn']
⇄products_gene_name => string (3) "CA1"
$value[8]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[8]['_source']['products_gene_name_syn']
⇄⧉products_description => string (572) "Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that cat...
$value[8]['_source']['products_description']
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it is a cytosolic protein which is found at the highest level in erythrocytes.
⇄products_references => string (3) "N/A"
$value[8]['_source']['products_references']
⇄⧉products_related_diseases => string (262) "Central Nervous System Diseases||5911!!Brain Ischemia||3257!!Cardiovascular ...
$value[8]['_source']['products_related_diseases']
Central Nervous System Diseases||5911!!Brain Ischemia||3257!!Cardiovascular Diseases||3134!!Memory Disorders||795!!Nerve Degeneration||698!!Neurobehavioral Manifestations||636!!Learning Disorders||616!!Brain Injuries||377!!Necrosis||362!!Cognition Disorders||311
C-MYB Transcription Factor Network Pathway||138073!!Metabolism Pathway||477135!!O2/CO2 Exchange In Erythrocytes Pathway||645346!!Reversible Hydration Of Carbon Dioxide Pathway||645352!!Uptake Of Carbon Dioxide And Release Of Oxygen By Erythrocytes Pathway||645347!!Uptake Of Oxygen And Release Of Carbon Dioxide By Erythrocytes Pathway||645348
⇄sp_protein_name => string (3) "N/A"
$value[8]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[8]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[8]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[8]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[8]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[8]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[8]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[8]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[8]['_source']['products_viewed']
⇄⧉search_terms => string (1116) "aaa24447 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in ...
$value[8]['_source']['search_terms']
aaa24447 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes ca1 elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 54.45kd using mbs648448_wb analysis of expression spleen mbs648448_wb2 transfected 293t cell line lane 1 lysate 28.9kd 2 non mbs648448_wb3 and protein magnetic bead immunoblotted rabbit polyclonal mbs648448_ip4 testing data limit for recombinant gst tagged is ~0.03ng ml capture mbs648448_td5 hela mbs648448_wb6 carbonic anhydrase i ca carbonate dehydratase b cab homo sapiens mrna car1 hel s 11 28,870 da 20380765 bc027890 aah27890 p00915 antibodies enzymes full length corresponding to aa1 261 from tag mw the alone 26kd sequence maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhnnrptqplkgrtvrasf conjugate ph7.2 lane1 28.9kd2 s11 aa1261
⇄specificity => string (21) "Recognizes human CA1."
$value[9]['_source']['specificity']
⇄purity => string (8) "Purified"
$value[9]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[9]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[9]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
$value[9]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[9]['_source']['app_notes']
⇄⧉testing_protocols => string (824) "WB (Western Blot)||CA1 monoclonal antibody, Western Blot analysis of CA1 exp...
$value[9]['_source']['testing_protocols']
WB (Western Blot)||CA1 monoclonal antibody, Western Blot analysis of CA1 expression in HeLa.||AAA25039_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged CA1 is ~0.03ng/ml as a capture antibody.||AAA25039_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of CA1 transfected lysate using 124177 and Protein A Magnetic Bead and immunoblotted with CA1 rabbit polyclonal antibody.||AAA25039_IP4.jpg!!WB (Western Blot)||Western Blot analysis of CA1 expression in transfected 293T cell line using 124177. Lane 1: CA1 transfected lysate (28.9kD). Lane 2: Non-transfected lysate.||AAA25039_WB3.jpg!!WB (Western Blot)||Western Blot analysis of CA1 expression in human spleen using 124177||AAA25039_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (54.45kD), using 124177.||AAA25039_WB.jpg
⇄⧉etc_term1 => string (440) "Immunogen||Full length recombinant protein corresponding to aa1-261 from hum...
$value[9]['_source']['etc_term1']
Immunogen||Full length recombinant protein corresponding to aa1-261 from human CA1 (AAH27890) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF!!Conjugate||FITC
CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (FITC)
⇄products_name_syn => string (3) "N/A"
$value[9]['_source']['products_name_syn']
⇄products_gene_name => string (3) "CA1"
$value[9]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[9]['_source']['products_gene_name_syn']
⇄⧉products_description => string (572) "Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that cat...
$value[9]['_source']['products_description']
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it is a cytosolic protein which is found at the highest level in erythrocytes.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄⧉products_related_diseases => string (262) "Central Nervous System Diseases||5911!!Brain Ischemia||3257!!Cardiovascular ...
$value[9]['_source']['products_related_diseases']
Central Nervous System Diseases||5911!!Brain Ischemia||3257!!Cardiovascular Diseases||3134!!Memory Disorders||795!!Nerve Degeneration||698!!Neurobehavioral Manifestations||636!!Learning Disorders||616!!Brain Injuries||377!!Necrosis||362!!Cognition Disorders||311
C-MYB Transcription Factor Network Pathway||138073!!Metabolism Pathway||477135!!O2/CO2 Exchange In Erythrocytes Pathway||645346!!Reversible Hydration Of Carbon Dioxide Pathway||645352!!Uptake Of Carbon Dioxide And Release Of Oxygen By Erythrocytes Pathway||645347!!Uptake Of Oxygen And Release Of Carbon Dioxide By Erythrocytes Pathway||645348
⇄sp_protein_name => string (3) "N/A"
$value[9]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[9]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[9]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[9]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[9]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[9]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[9]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[9]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[9]['_source']['products_viewed']
⇄⧉search_terms => string (1129) "aaa25039 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in ...
$value[9]['_source']['search_terms']
aaa25039 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes ca1 elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 54.45kd using 124177 aaa25039_wb analysis of expression spleen aaa25039_wb2 transfected 293t cell line lane 1 lysate 28.9kd 2 non aaa25039_wb3 and protein magnetic bead immunoblotted rabbit polyclonal aaa25039_ip4 testing data limit for recombinant gst tagged is ~0.03ng ml capture aaa25039_td5 hela aaa25039_wb6 carbonic anhydrase i ca carbonate dehydratase b cab homo sapiens mrna car1 hel s 11 28,870 da 20380765 bc027890 aah27890 p00915 antibodies enzymes full length corresponding to aa1 261 from tag mw the alone 26kd sequence maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhnnrptqplkgrtvrasf conjugate ph7.2 lane1 28.9kd2 s11 aa1261
⇄specificity => string (21) "Recognizes human CA1."
$value[10]['_source']['specificity']
⇄purity => string (8) "Purified"
$value[10]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[10]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[10]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
$value[10]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[10]['_source']['app_notes']
⇄⧉testing_protocols => string (824) "WB (Western Blot)||CA1 monoclonal antibody, Western Blot analysis of CA1 exp...
$value[10]['_source']['testing_protocols']
WB (Western Blot)||CA1 monoclonal antibody, Western Blot analysis of CA1 expression in HeLa.||AAA25628_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged CA1 is ~0.03ng/ml as a capture antibody.||AAA25628_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of CA1 transfected lysate using 124177 and Protein A Magnetic Bead and immunoblotted with CA1 rabbit polyclonal antibody.||AAA25628_IP4.jpg!!WB (Western Blot)||Western Blot analysis of CA1 expression in transfected 293T cell line using 124177. Lane 1: CA1 transfected lysate (28.9kD). Lane 2: Non-transfected lysate.||AAA25628_WB3.jpg!!WB (Western Blot)||Western Blot analysis of CA1 expression in human spleen using 124177||AAA25628_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (54.45kD), using 124177.||AAA25628_WB.jpg
⇄⧉etc_term1 => string (438) "Immunogen||Full length recombinant protein corresponding to aa1-261 from hum...
$value[10]['_source']['etc_term1']
Immunogen||Full length recombinant protein corresponding to aa1-261 from human CA1 (AAH27890) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF!!Conjugate||PE
CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (PE)
⇄products_name_syn => string (3) "N/A"
$value[10]['_source']['products_name_syn']
⇄products_gene_name => string (3) "CA1"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (572) "Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that cat...
$value[10]['_source']['products_description']
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it is a cytosolic protein which is found at the highest level in erythrocytes.
⇄products_references => string (3) "N/A"
$value[10]['_source']['products_references']
⇄⧉products_related_diseases => string (262) "Central Nervous System Diseases||5911!!Brain Ischemia||3257!!Cardiovascular ...
C-MYB Transcription Factor Network Pathway||138073!!Metabolism Pathway||477135!!O2/CO2 Exchange In Erythrocytes Pathway||645346!!Reversible Hydration Of Carbon Dioxide Pathway||645352!!Uptake Of Carbon Dioxide And Release Of Oxygen By Erythrocytes Pathway||645347!!Uptake Of Oxygen And Release Of Carbon Dioxide By Erythrocytes Pathway||645348
⇄sp_protein_name => string (3) "N/A"
$value[10]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[10]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[10]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[10]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[10]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[10]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[10]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[10]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[10]['_source']['products_viewed']
⇄⧉search_terms => string (1116) "aaa25628 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in ...
$value[10]['_source']['search_terms']
aaa25628 mouse human monoclonal igg2a,k m1 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes ca1 elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 54.45kd using 124177 aaa25628_wb analysis of expression spleen aaa25628_wb2 transfected 293t cell line lane 1 lysate 28.9kd 2 non aaa25628_wb3 and protein magnetic bead immunoblotted rabbit polyclonal aaa25628_ip4 testing data limit for recombinant gst tagged is ~0.03ng ml capture aaa25628_td5 hela aaa25628_wb6 carbonic anhydrase i ca carbonate dehydratase b cab homo sapiens mrna car1 hel s 11 28,870 da 20380765 bc027890 aah27890 p00915 antibodies enzymes full length corresponding to aa1 261 from tag mw the alone 26kd sequence maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhnnrptqplkgrtvrasf conjugate ph7.2 lane1 28.9kd2 s11 aa1261
⇄⧉specificity => string (564) "Recognizes a glycoprotein of ~200kDa, identified as carbonic anhydrase IX (C...
$value[11]['_source']['specificity']
Recognizes a glycoprotein of ~200kDa, identified as carbonic anhydrase IX (CAIX/gp200). In normal kidney, gp200 is localized along the brush border of the pars convoluta and pars recta segments of the proximal tubule, as well as focally along the luminal surface of Bowmans capsule adjoining the outgoing proximal tubule. Reportedly, gp200 is expressed by 93% of primary and 84% of metastatic renal cell carcinomas. This MAb may be useful in the investigations of carcinomas of proximal nephrogenic differentiation especially those showing tubular differentiation.
⇄⧉purity => string (137) "Purified Ab with BSA and Azide at 200ug/ml or Purified Ab with BSA and Azide...
$value[11]['_source']['purity']
Purified Ab with BSA and Azide at 200ug/ml or Purified Ab with BSA and Azide at 200ug/ml or Purified Ab WITHOUT BSA and Azide at 1.0mg/ml
⇄⧉form => string (166) "200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared...
$value[11]['_source']['form']
200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (173) "Antibody with azide: store at 2 to 8 degree C.<br>Antibody without azide: st...
$value[11]['_source']['storage_stability']
Antibody with azide: store at 2 to 8 degree C.<br>Antibody without azide: store at -20 to -80 degree C.<br>Antibody is stable for 24 months. Non-hazardous. No MSDS required.
⇄⧉app_tested => string (80) "Flow Cytometry (FC/FACS), Immunohistochemistry (IHC) Paraffin, Western Blot ...
$value[11]['_source']['app_tested']
Flow Cytometry (FC/FACS), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
FC/FACS: 1-2ug/million cells<br>WB: 1-2ug/ml<br>IHC-P: 1-2ug/ml for 30 minutes at RT<br>Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95 degree C followed by cooling at RT for 20 minutes
⇄⧉testing_protocols => string (1932) "Application Data||Analysis of Protein Array containing more than 19,000 full...
$value[11]['_source']['testing_protocols']
Application Data||Analysis of Protein Array containing more than 19,000 full-length human proteins using CAIX-Monospecific Mouse Monoclonal Antibody (CA9/3406). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.||AAA23952_APP6.jpg!!FCM (Flow Cytometry)||Flow Cytometric Analysis of PFA-fixed U87MG cells using CAIX-Monospecific Mouse Monoclonal Antibody (CA9/3406) followed by goat anti-mouse IgG-CF488 (Blue); Isotype Control (Red).||AAA23952_FCM5.jpg!!WB (Western Blot)||Western Blot Analysis of HEK293 cell lysate using RCC Mouse Monoclonal Antibody (CA9/3406).||AAA23952_WB4.jpg!!SDS-PAGE||SDS-PAGE Analysis Purified CAIX-Monospecific Mouse Monoclonal Antibody (CA9/3406). Confirmation of Integrity and Purity of Antibody.||AAA23952_SDS_PAGE3.jpg!!IHC (Immunohistochemistry-Formalin)||Formalin-fixed, paraffin-embedded human Kidney stained with CAIX-Monospecific Mouse Monoclonal Antibody (CA9/3406).||AAA23952_IHC2.jpg!!IHC (Immunohistochemistry-Formalin)||Formalin-fixed, paraffin-embedded human Kidney stained with CAIX-Monospecific Mouse Monoclonal Antibody (CA9/3406).||AAA23952_IHC.jpg
⇄⧉etc_term1 => string (153) "Immunogen||Recombinant Human CA9 protein fragment (around aa 314-410) (exact...
$value[11]['_source']['etc_term1']
Immunogen||Recombinant Human CA9 protein fragment (around aa 314-410) (exact sequence is proprietary)!!Cellular Localization||Cell Surfaceand Cytoplasmic
⇄⧉ncbi_pathways => string (379) "Cellular Response To Hypoxia Pathway||645259!!Cellular Responses To Stress P...
$value[11]['_source']['ncbi_pathways']
Cellular Response To Hypoxia Pathway||645259!!Cellular Responses To Stress Pathway||645258!!HIF-1-alpha Transcription Factor Network Pathway||138045!!Metabolism Pathway||477135!!Regulation Of Gene Expression By Hypoxia-inducible Factor Pathway||645263!!Regulation Of Hypoxia-inducible Factor (HIF) By Oxygen Pathway||645260!!Reversible Hydration Of Carbon Dioxide Pathway||645352
⇄⧉search_terms => string (1965) "aaa23952 mouse human monoclonal igg2b kappa ca9 3406 purified ab with bsa an...
$value[11]['_source']['search_terms']
aaa23952 mouse human monoclonal igg2b kappa ca9 3406 purified ab with bsa and azide at 200ug ml or without 1.0mg of from bioreactor concentrate by protein a g prepared in 10mm pbs 0.05 also available recognizes glycoprotein ~200kda identified as carbonic anhydrase ix caix gp200 normal kidney is localized along the brush border pars convoluta recta segments proximal tubule well focally luminal surface bowmans capsule adjoining outgoing reportedly expressed 93 primary 84 metastatic renal cell carcinomas this mab may be useful investigations nephrogenic differentiation especially those showing tubular flow cytometry fc facs immunohistochemistry ihc paraffin western blot wb 1 2ug million cells p for 30 minutes rt staining formalin fixed tissues requires heating tissue sections tris 1mm edta ph 9.0 45 min 95 degree c followed cooling 20 formallin embedded stained monospecific antibody aaa23952_ihc aaa23952_ihc2 sds page analysis confirmation integrity purity aaa23952_sds3 hek293 lysate using rcc aaa23952_wb4 cytometric pfa u87mg goat anti igg cf488 blue isotype control red aaa23952_fc5 testing data array containing more than 19,000 full length proteins z s score represents strength signal that combination fluorescently tagged secondary produces when binding to particular on huprottm scores are described units standard deviations sd&apos above mean value all signals generated if targets arranged descending order difference between therefore relative target specificity its intended considered specific has an least 2.5 example binds x 43 y 14 then equal 29 aaa23952_td6 carcinoma carbonate dehydratase 9 g250 membrane antigen mn p54 58n pmw1 associated 55kda ca 119578763 eaw58359.1 q16790 immunogen recombinant fragment around aa 314 410 exact sequence proprietary cellular localization surfaceand cytoplasmic hu chromosome location 9p13.3 positive expressed93 primary84 wb1 for30 ph9.0 min95 cooling20 least2.5 x43 y14 equal29 dehydratase9 aa314
⇄⧉specificity => string (388) "This assay has high sensitivity and excellent specificity for detection of N...
$value[13]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of N-MID-OC. No significant cross-reactivity or interference between N-MID-OC and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between N-MID-OC and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[13]['_source']['purity']
⇄form => string (3) "N/A"
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||1.0 ng/mL
⇄⧉etc_term2 => string (206) "Intended Uses||This N-MID-OT ELISA kit is a 1.5 hour solid-phase ELISA desig...
$value[13]['_source']['etc_term2']
Intended Uses||This N-MID-OT ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Monkey N-MID-OT. This ELISA kit for research use only, not for therapeutic applications!
⇄⧉products_description => string (1442) "Principle of the Assay: N-MID-OC ELISA kit applies the competitive enzyme im...
$value[13]['_source']['products_description']
Principle of the Assay: N-MID-OC ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-N-MID-OC antibody and an N-MID-OC-HRP conjugate. The assay sample and buffer are incubated together with N-MID-OC-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the N-MID-OC concentration since N-MID-OC from samples and N-MID-OC-HRP conjugate compete for the anti-N-MID-OC antibody binding site. Since the number of sites is limited, as more sites are occupied by N-MID-OC from the sample, fewer sites are left to bind N-MID-OC-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The N-MID-OC concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This N-MID-OC ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Monkey N-MID-OC. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (389) "aaa17078 monkey typical testing data standard curve for reference only aaa17...
$value[13]['_source']['search_terms']
aaa17078 monkey typical testing data standard curve for reference only aaa17078_td elisa kit n mid osteocalcin ot samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive sensitivity 1.0 pg ml intended uses this is a 1.5 hour solid phase designed the quantitative determination of research use not therapeutic applications! sensitivity1.0 a1.5
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition
Western blotting: 0.01-2ug/mL;<br>Immunohistochemistry: 5-20ug/mL;<br>Immunocytochemistry: 5-20ug/mL;<br>Optimal working dilutions must be determined by end user.
⇄⧉search_terms => string (697) "aaa20112 rabbit homo sapiens human polyclonal immunoglobulin type igg antige...
$value[15]['_source']['search_terms']
aaa20112 rabbit homo sapiens human polyclonal immunoglobulin type igg antigen specific affinity chromatography followed by protein a liquid supplied as solution form in 0.01m pbs ph7.4 containing 0.05 proclin 300 50 glycerol western blot wb immunocytochemistry icc immunohistochemistry ihc immunoprecipitation ip 0.5 2 ug ml 5 20 optimal working dilutions must be determined end user sample recombinant inhbe aaa20112_wb dab staining on formalin fixed paraffin embedded liver tissue aaa20112_ihc antibody inhibin beta e to chain preproprotein subunit activin 13899338 p58166 nm_031479.4 af412024 mrna immunogen thr237~ser350 with n terminal his tag expressed e.coli mbs2012336 proclin300 ip0.5 ml5
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use. <br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (17) "Western Blot (WB)"
$value[16]['_source']['app_tested']
⇄⧉app_notes => string (90) "Western blotting: 0.01-2ug/mL<br>Optimal working dilutions must be determine...
$value[16]['_source']['app_notes']
Western blotting: 0.01-2ug/mL<br>Optimal working dilutions must be determined by end user.
⇄⧉search_terms => string (774) "aaa21022 rabbit human polyclonal antigen specific affinity chromatography fo...
$value[16]['_source']['search_terms']
aaa21022 rabbit human polyclonal antigen specific affinity chromatography followed by protein a supplied as solution form in pbs ph7.4 containing 0.02 nan3 50 glycerol western blot wb immunohistochemistry ihc immunocytochemistry icc immunoprecipitation ip 0.5 2ug ml 5 20ug optimal working dilution must be determined end user sample recombinant nat8l aaa21022_wb dab staining on fromalin fixed paraffin embedded brain tissue aaa21022_ihc antibody n acetyltransferase 8 like hcml3 cml3 naa synthetase acetylaspartate camello 3 naced nat8 263192221 np_848652.2 q8n9f0 nm_178557.3 al132868 genomic dna organism species homo sapiens source preparation traits liquid immunogen met1~glu302 expressed e.coli mbs2033485 cross reactivity nan350 ip0.5 ml5 acetyltransferase8 camello3
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Western blotting: 0.01-2ug/mL<br>Immunohistochemistry: 5-20ug/mL<br>Immunocytochemistry: 5-20ug/mL<br>Optimal working dilutions must be determined by end user.
⇄⧉ncbi_pathways => string (462) "Amoebiasis Pathway||167324!!Amoebiasis Pathway||167191!!Assembly Of Collagen...
$value[17]['_source']['ncbi_pathways']
Amoebiasis Pathway||167324!!Amoebiasis Pathway||167191!!Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway||730306!!Binding And Uptake Of Ligands By Scavenger Receptors Pathway||771599!!Collagen Biosynthesis And Modifying Enzymes Pathway||645289!!Collagen Formation Pathway||645288!!ECM-receptor Interaction Pathway||83068!!ECM-receptor Interaction Pathway||479!!Extracellular Matrix Organization Pathway||576262!!Focal Adhesion Pathway||198795
⇄⧉search_terms => string (752) "aaa20138 rabbit homo sapiens human antigen specific affinity chromatography ...
$value[17]['_source']['search_terms']
aaa20138 rabbit homo sapiens human antigen specific affinity chromatography followed by protein a supplied as solution form in 0.01m pbs ph7.4 containing 0.05 proclin 300 50 glycerol western blot wb immunohistochemistry ihc immunocytochemistry icc immunoprecipitation ip blotting 0.5 2ug ml 5 20ug optimal working dilutions must be determined end user sample recombinant pinp aaa20138_wb antibody procollagen i n terminal propeptide polyclonal to collagen alpha 1 chain preproprotein type col1a1 oi1 oi2 oi3 oi4 edsc 110349772 p02452 nm_000088.3 o76045 p78441 q13896 q13902 q13903 q14037 q14992 q15176 q15201 q16050 q59f64 z74615 mrna source preparation traits liquid immunogen gln23~pro161 expressed e.coli mbs2097551 proclin300 blotting0.5 ml5 alpha1
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Western blotting: 0.5-2ug/mL<br>Immunohistochemistry: 5-20ug/mL<br>Immunocytochemistry: 5-20ug/mL<br>Optimal working dilutions must be determined by end user.
⇄⧉testing_protocols => string (646) "IHC (Immunohistchemistry)||DAB staining on IHC-P;<br>Samples: Rat Pancreas T...
$value[18]['_source']['testing_protocols']
IHC (Immunohistchemistry)||DAB staining on IHC-P;<br>Samples: Rat Pancreas Tissue;<br>Primary Ab: 10ug/ml Rabbit Anti-Rat vWF Antibody<br>Second Ab: 2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody(Immunohistochemistry)||DAB staining on IHC-P;<br>Samples: Rat Pancreas Tissue||AAA20090_IHC5.jpg!!WB (Western Blot)||Western Blot;<br>Sample: Rat Plasma<br>Primary Ab: 2ug/ml Rabbit Anti-Rat vWF Antibody<br>Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody (Western Blot)||Western Blot:<br>Sample: Recombinant vWF, Rat.||AAA20090_WB2.jpg!!WB (Western Blot)||Western Blot:<br>Sample: Rat Serum.||AAA20090_WB.jpg
⇄⧉search_terms => string (979) "aaa20090 rabbit rat polyclonal affinity chromatography supplied as solution ...
$value[18]['_source']['search_terms']
aaa20090 rabbit rat polyclonal affinity chromatography supplied as solution form in pbs ph7.4 containing 0.02 nan3,50 glycerol the antibody is a raised against vwf it has been selected for its ability to recognize immunohistochemical staining andwestern blotting immunocytochemistry icc immunohistochemistry ihc formalin paraffin elisa eia western blot wb 1:100 400 fixed cells 500 frozen section 1:50 200 enzyme linked immunosorbent assay sample serum aaa20090_wb recombinant aaa20090_wb2 dab on p samples pancreas tissue aaa20090_ihc aaa20090_ihc2 antigen target protein fused with n terminal his tag and sequence listed below mghhhhhhsg sef sl vldvvfvlea sdevgeanfn kskefleevi qrmdvspagt hiavlqysyt vnveytfkea qskedvlrhv reiryqggnr tntgqalqyl sehsfsp von willebrand factor 48,139 da 56404678 q62935.2 q62935 q78e31 q9z0p2 immunogen ser269~pro367 expressed e.coli cross reactivity conjugated apc version of this item also available catalog #mbs2048301 1:100400 cells500 1:50200
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 4 degree C for frequent use.<br>Aliquot and store at -20 degree C for 24 months.<br><br><b>Stability Test:</b><br>thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Western blotting: 0.5-2ug/mL<br>Immunohistochemistry: 5-20ug/mL<br>Immunocytochemistry: 5-20ug/mL<br>Optimal working dilutions must be determined by end user.
aaa20111 rabbit mus musculus mouse polyclonal igg affinity chromatography supplied as solution form in 0.01m pbs ph7.4 containing 0.05 proclin 300 50 glycerol the antibody is a raised against tigit it has been selected for its ability to recognize immunohistochemical staining and western blotting blot wb immunocytochemistry icc immunohistochemistry ihc immunoprecipitation ip blotting:0.5 2ug ml 5 20ug optimal working dilutions must be determined by end user sample spleen tissue aaa20111_wb recombinant aaa20111_wb2 used dab on fromalin fixed paraffin embedded aaa20111_ihc t cell immunoreceptor with ig itim domains protein vstm3 v set transmembrane domain 3 224493410 p86176.1 p86176 immunogen gly28~ser246 two n terminal tags histag t7 tag expressed e.coli mbs2009409
traits liquid proclin300 ml5 domain3
