Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACCN5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit anti-Horse, Human ACCN5 Polyclonal Antibody | anti-ASIC5 antibody

ACCN5 antibody - middle region

Gene Names
ASIC5; INAC; ACCN5; HINAC
Reactivity
Horse, Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
ACCN5; Polyclonal Antibody; ACCN5 antibody - middle region; anti-ASIC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
Sequence Length
505
Applicable Applications for anti-ASIC5 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACCN5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACCN5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ACCN5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ASIC5 antibody
This is a rabbit polyclonal antibody against ACCN5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
Product Categories/Family for anti-ASIC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
acid-sensing ion channel 5
NCBI Official Synonym Full Names
acid sensing ion channel subunit family member 5
NCBI Official Symbol
ASIC5
NCBI Official Synonym Symbols
INAC; ACCN5; HINAC
NCBI Protein Information
acid-sensing ion channel 5
UniProt Protein Name
Acid-sensing ion channel 5
Protein Family
UniProt Gene Name
ASIC5
UniProt Synonym Gene Names
ACCN5; HINAC; ASIC5; HINaC
UniProt Entry Name
ASIC5_HUMAN

NCBI Description

This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008]

Research Articles on ASIC5

Similar Products

Product Notes

The ASIC5 asic5 (Catalog #AAA3203711) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACCN5 antibody - middle region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACCN5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASIC5 asic5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTEYGNCFTF NHGETLQAKR KVSVSGRGLS LLFNVNQEAF TDNPALGFVD. It is sometimes possible for the material contained within the vial of "ACCN5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.