Western Blot (WB)
(ACCN5 antibody used at 1.25 ug/ml to detect target protein.)
Rabbit ACCN5 Polyclonal Antibody | anti-ACCN5 antibody
ACCN5 Antibody
Gene Names
ASIC5; INAC; ACCN5; HINAC
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
ACCN5; Polyclonal Antibody; ACCN5 Antibody; Rabbit Polyclonal ACCN5 Antibody raised against the middle region of ACCN5; Polyclonal ACCN5 antibody; Anti-ACCN5 antibody; ACCN-5; ACCN 5; ACCN 5 antibody; ASIC5 antibody; ACCN-5 antibody; Amiloride-Sensitive Cation Channel 5 Intestinal antibody; anti-ACCN5 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
ACCN5 antibody was raised against the middle region of ACCN5
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
505
Applicable Applications for anti-ACCN5 antibody
Western Blot (WB)
Application Notes
This is a rabbit polyclonal antibody against ACCN5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 1.25 ug/ml
WB: 1.25 ug/ml
Immunogen
ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
Cross-Reactivity
Human
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(ACCN5 antibody used at 1.25 ug/ml to detect target protein.)
Western Blot (WB)
(ACCN5 antibody used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-ACCN5 antibody
ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
Product Categories/Family for anti-ACCN5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56 kDa (MW of target protein)
NCBI Official Full Name
acid-sensing ion channel 5
NCBI Official Synonym Full Names
acid sensing ion channel subunit family member 5
NCBI Official Symbol
ASIC5
NCBI Official Synonym Symbols
INAC; ACCN5; HINAC
NCBI Protein Information
acid-sensing ion channel 5
UniProt Protein Name
Acid-sensing ion channel 5
UniProt Gene Name
ASIC5
UniProt Synonym Gene Names
ACCN5; HINAC; ASIC5; HINaC
UniProt Entry Name
ASIC5_HUMAN
NCBI Description
This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008]
Research Articles on ACCN5
Similar Products
Product Notes
The ACCN5 asic5 (Catalog #AAA5313154) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACCN5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). This is a rabbit polyclonal antibody against ACCN5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the ACCN5 asic5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACCN5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
