Western Blot (WB)
(WB Suggested Anti-Abcb10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Spleen)
Rabbit Abcb10 Polyclonal Antibody | anti-ABCB10 antibody
Abcb10 antibody - N-terminal region
Gene Names
Abcb10; Abc-me; Abcb12
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Abcb10; Polyclonal Antibody; Abcb10 antibody - N-terminal region; anti-ABCB10 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD
Sequence Length
715
Applicable Applications for anti-ABCB10 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 85%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Abcb10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Spleen)
Western Blot (WB)
(WB Suggested Anti-Abcb10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Spleen)
Related Product Information for anti-ABCB10 antibody
This is a rabbit polyclonal antibody against Abcb10. It was validated on Western Blot
Target Description: Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
Target Description: Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
Product Categories/Family for anti-ABCB10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
ATP-binding cassette sub-family B member 10, mitochondrial
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family B (MDR/TAP), member 10
NCBI Official Symbol
Abcb10
NCBI Official Synonym Symbols
Abc-me; Abcb12
NCBI Protein Information
ATP-binding cassette sub-family B member 10, mitochondrial
UniProt Protein Name
ATP-binding cassette sub-family B member 10, mitochondrial
Protein Family
UniProt Gene Name
Abcb10
UniProt Synonym Gene Names
ABC-me protein; ABC transporter 10 protein
UniProt Entry Name
ABCBA_MOUSE
NCBI Description
This gene encodes a member of the ATP-binding cassette superfamily of transporters. ATP-binding cassette proteins transport various molecules across extra- and intra-cellular membranes. The encoded protein is localized to the mitochondrial inner membrane where it interacts with and stabilizes mitoferrin-1, and is important for heme biosynthesis. Additional evidence suggests the encoded protein is involved in oxidative stress protection and erythropoisesis. [provided by RefSeq, May 2013]
Research Articles on ABCB10
Similar Products
Product Notes
The ABCB10 abcb10 (Catalog #AAA3206988) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Abcb10 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Abcb10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABCB10 abcb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGIRVYLMQS SGQSIVNRLR TSLFSSILRQ EVAFFDKTRT GELINRLSSD. It is sometimes possible for the material contained within the vial of "Abcb10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
