Western Blot (WB)
(WB Suggested Anti-Abca1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Mouse Kidney)
Rabbit Abca1 Polyclonal Antibody | anti-ABCA1 antibody
Abca1 antibody - middle region
Gene Names
Abca1; Abc1; ABC-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Abca1; Polyclonal Antibody; Abca1 antibody - middle region; anti-ABCA1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK
Sequence Length
2261
Applicable Applications for anti-ABCA1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Abca1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Mouse Kidney)
Western Blot (WB)
(WB Suggested Anti-Abca1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Mouse Kidney)
Related Product Information for anti-ABCA1 antibody
This is a rabbit polyclonal antibody against Abca1. It was validated on Western Blot
Target Description: Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport.
Target Description: Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport.
Product Categories/Family for anti-ABCA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
254kDa
NCBI Official Full Name
ATP-binding cassette sub-family A member 1
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family A (ABC1), member 1
NCBI Official Symbol
Abca1
NCBI Official Synonym Symbols
Abc1; ABC-1
NCBI Protein Information
ATP-binding cassette sub-family A member 1
Protein Family
NCBI Description
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. In humans, this protein functions as a cholesterol efflux pump in the cellular lipid removal pathway. Mutations in the human gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency. [provided by RefSeq, Jul 2008]
Research Articles on ABCA1
Similar Products
Product Notes
The ABCA1 (Catalog #AAA3206980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Abca1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Abca1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABCA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRRAFGDKQS CLHPFTEDDA VDPNDSDIDP ESRETDLLSG MDGKGSYQLK. It is sometimes possible for the material contained within the vial of "Abca1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
