Rabbit ABCB10 Polyclonal Antibody | anti-ABCB10 antibody

Anti-ABCB10 Antibody

Cat. Num. AAA178471

• Gene Names: ABCB10; M-ABC2; MTABC2; EST20237
• Reactivity: Human, Rat; No cross reactivity with other proteins.
• Applications: Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: ABCB10; Polyclonal Antibody; Anti-ABCB10 Antibody; ABC transporter 10 protein; EST20237; M ABC2; M-ABC2; MTABC2; Q9NRK6; ATP-binding cassette sub-family B member 10; mitochondrial; ATP binding cassette subfamily B member 10; anti-ABCB10 antibody

• Host: Rabbit
• Reactivity: Human, Rat; No cross reactivity with other proteins.
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized
• Sequence Length: 738

• Applicable Applications for anti-ABCB10 antibody: Western Blot (WB)
• Application Notes: Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat; Tested Species:In-house tested species with positive results.; Other applications have not been tested.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.
• Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ABCB10 expression in rat cardiac muscle extract (lane 1), COLO320 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and PANC whole cell lysates (lane 4). ABCB10 at 79KD, 65KD was detected using rabbit anti- ABCB10 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-ABCB10 antibody

Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial (ABCB10) detection.
Background: ABCB10, also known as M-ABC2, is expressed as a 60-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

References

1. Allikmets, R., Gerrard, B., Glavac, D., Ravnik-Glavac, M., Jenkins, N. A., Gilbert, D. J., Copeland, N. G., Modi, W., Dean, M.Characterization and mapping of three new mammalian ATP-binding transporter genes from an EST database. Mammalian Genome 6: 114-117, 1995.
2. Chen, W., Paradkar, P. N., Li, L., Pierce, E. L., Langer, N. B., Takahashi-Makise, N., Hyde, B. B., Shirihai, O. S., Ward, D. M., Kaplan, J., Paw, B. H. Abcb10 physically interacts with mitoferrin-1 (Slc25a37) to enhance its stability and function in the erythroid mitochondria. Proc. Nat. Acad. Sci. 106: 16263-16268, 2009.
3. Zhang, F., Hogue, D. L., Liu, L., Fisher, C. L., Hui, D., Childs, S., Ling, V. M-ABC2, a new human mitochondrial ATP-binding cassette membrane protein. FEBS Lett. 478: 89-94, 2000.

NCBI and Uniprot Product Information

• NCBI GI #: 171184400
• NCBI GeneID: 23456
• NCBI Accession #: NP_036221.2
• NCBI GenBank Nucleotide #: NM_012089.2
• UniProt Accession #: Q9NRK6; Q13040; Q6P1Q8; Q9H3V0
• Molecular Weight: 79,148 Da
• NCBI Official Full Name: ATP-binding cassette sub-family B member 10, mitochondrial
• NCBI Official Synonym Full Names: ATP binding cassette subfamily B member 10
• NCBI Official Symbol: ABCB10
• NCBI Official Synonym Symbols: M-ABC2; MTABC2; EST20237
• NCBI Protein Information: ATP-binding cassette sub-family B member 10, mitochondrial
• UniProt Protein Name: ATP-binding cassette sub-family B member 10, mitochondrial
• Protein Family: ABC transporter B family
• UniProt Gene Name: ABCB10
• UniProt Synonym Gene Names: ABC transporter 10 protein; M-ABC2
• UniProt Entry Name: ABCBA_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCB10: May mediate critical mitochondrial transport functions related to heme biosynthesis. Belongs to the ABC transporter superfamily. ABCB family. Mitochondrial peptide exporter (TC 3.A.1.212) subfamily.

Protein type: Transporter; Membrane protein, multi-pass; Mitochondrial; Membrane protein, integral; Hydrolase; Transporter, ABC family

Chromosomal Location of Human Ortholog: 1q42.13

Molecular Function: ATPase activity, coupled to transmembrane movement of substances

Biological Process: transmembrane transport