Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Ecsit Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Heart)

Rabbit anti-Mouse Ecsit Polyclonal Antibody | anti-ECSIT antibody

Ecsit antibody - N-terminal region

Gene Names
Ecsit; Sitpec
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ecsit; Polyclonal Antibody; Ecsit antibody - N-terminal region; anti-ECSIT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN
Sequence Length
435
Applicable Applications for anti-ECSIT antibody
Western Blot (WB)
Homology
Mouse: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Ecsit Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Ecsit Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-ECSIT antibody
This is a rabbit polyclonal antibody against Ecsit. It was validated on Western Blot

Target Description: Ecsit is required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase. Ecsit is an adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1.Ecsit promotes proteolytic activation of MAP3K1. Ecsit is involved in the BMP signaling pathway. Ecsit is required for normal embryonic development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
NCBI Official Synonym Full Names
ECSIT signalling integrator
NCBI Official Symbol
Ecsit
NCBI Official Synonym Symbols
Sitpec
NCBI Protein Information
evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
UniProt Protein Name
Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
UniProt Gene Name
Ecsit
UniProt Synonym Gene Names
Sitpec
UniProt Entry Name
ECSIT_MOUSE

Uniprot Description

ECSIT: Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development. Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase. Belongs to the ECSIT family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Adaptor/scaffold

Cellular Component: nucleoplasm; transcription factor complex; mitochondrion; cytoplasm; nucleus

Molecular Function: signal transducer activity; protein binding; oxidoreductase activity, acting on NADH or NADPH; transcription factor activity

Biological Process: BMP signaling pathway; regulation of transcription from RNA polymerase II promoter; mesoderm formation; immune system process; transmembrane receptor protein serine/threonine kinase signaling pathway; innate immune response; regulation of oxidoreductase activity

Research Articles on ECSIT

Similar Products

Product Notes

The ECSIT ecsit (Catalog #AAA3203483) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ecsit antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Ecsit can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ECSIT ecsit for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPWLVPRPPE PQRKPIKVPA MHEDSFKPSG NRERDKASFL NAVRSFGAHN. It is sometimes possible for the material contained within the vial of "Ecsit, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.