Western Blot (WB)
(WB Suggested Anti-SLC38A5 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Rabbit SLC38A5 Polyclonal Antibody | anti-SLC38A5 antibody
SLC38A5 antibody - N-terminal region
Gene Names
SLC38A5; SN2; JM24; SNAT5; pp7194
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC38A5; Polyclonal Antibody; SLC38A5 antibody - N-terminal region; anti-SLC38A5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT
Sequence Length
472
Applicable Applications for anti-SLC38A5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SLC38A5 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SLC38A5 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-SLC38A5 antibody
This is a rabbit polyclonal antibody against SLC38A5. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine. The encoded protein does not transport charged amino acids, imino acids, or N-
Target Description: The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine. The encoded protein does not transport charged amino acids, imino acids, or N-
Product Categories/Family for anti-SLC38A5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
sodium-coupled neutral amino acid transporter 5
NCBI Official Synonym Full Names
solute carrier family 38 member 5
NCBI Official Symbol
SLC38A5
NCBI Official Synonym Symbols
SN2; JM24; SNAT5; pp7194
NCBI Protein Information
sodium-coupled neutral amino acid transporter 5
UniProt Protein Name
Sodium-coupled neutral amino acid transporter 5
Protein Family
UniProt Gene Name
SLC38A5
UniProt Synonym Gene Names
JM24; SN2; SNAT5; PP7194
UniProt Entry Name
S38A5_HUMAN
NCBI Description
The protein encoded by this gene is a system N sodium-coupled amino acid transporter. The encoded protein transports glutamine, asparagine, histidine, serine, alanine, and glycine across the cell membrane, but does not transport charged amino acids, imino acids, or N-alkylated amino acids. Alternative splicing results in multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Aug 2013]
Research Articles on SLC38A5
Similar Products
Product Notes
The SLC38A5 slc38a5 (Catalog #AAA3207193) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC38A5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC38A5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC38A5 slc38a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIRAYEQLGQ RAFGPAGKVV VATVICLHNV GAMSSYLFII KSELPLVIGT. It is sometimes possible for the material contained within the vial of "SLC38A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
