Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADSSL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Rabbit ADSSL1 Polyclonal Antibody | anti-ADSSL1 antibody

ADSSL1 antibody - middle region

Gene Names
ADSSL1; MPD5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADSSL1; Polyclonal Antibody; ADSSL1 antibody - middle region; anti-ADSSL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS
Sequence Length
457
Applicable Applications for anti-ADSSL1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADSSL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADSSL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-ADSSL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)
Related Product Information for anti-ADSSL1 antibody
This is a rabbit polyclonal antibody against ADSSL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ADSSL1 is a muscle isozyme of adenylosuccinate synthase (EC 6.3.4.4), which catalyzes the initial reaction in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP).
Product Categories/Family for anti-ADSSL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
adenylosuccinate synthetase isozyme 1 isoform 2
NCBI Official Synonym Full Names
adenylosuccinate synthase like 1
NCBI Official Symbol
ADSSL1
NCBI Official Synonym Symbols
MPD5
NCBI Protein Information
adenylosuccinate synthetase isozyme 1
UniProt Protein Name
Adenylosuccinate synthetase isozyme 1
UniProt Gene Name
ADSSL1
UniProt Synonym Gene Names
ADSS1; AMPSase 1; AdSS 1
UniProt Entry Name
PURA1_HUMAN

NCBI Description

This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent onset distal myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

Function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP

By similarity. HAMAP-Rule MF_03126

Catalytic activity: GTP + IMP + L-aspartate = GDP + phosphate + N(6)-(1,2-dicarboxyethyl)-AMP. HAMAP-Rule MF_03126

Cofactor: Binds 1 magnesium ion per subunit

By similarity. HAMAP-Rule MF_03126

Pathway: Purine metabolism; AMP biosynthesis via de novo pathway; AMP from IMP: step 1/2. HAMAP-Rule MF_03126

Subunit structure: Homodimer

By similarity. HAMAP-Rule MF_03126

Subcellular location: Cytoplasm Ref.1.

Tissue specificity: Predominantly expressed in skeletal muscle and heart, as well as in several hematopoietic cell lines and solid tumors. Ref.1

Sequence similarities: Belongs to the adenylosuccinate synthetase family.

Sequence caution: The sequence AAH32039.1 differs from that shown. Reason: Frameshift at position 1. The sequence CAD62614.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on ADSSL1

Similar Products

Product Notes

The ADSSL1 adssl1 (Catalog #AAA3209018) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADSSL1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ADSSL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADSSL1 adssl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VDGLQEVQRQ AQEGKNIGTT KKGIGPTYSS KAARTGLRIC DLLSDFDEFS. It is sometimes possible for the material contained within the vial of "ADSSL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.