Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of A2ML1 expression in transfected 293T cell line by A2ML1 polyclonal antibody. Lane1:A2ML1 transfected lysate (17.38kD). Lane2:Non-transfected lysate.)

Mouse anti-Human A2ML1 Polyclonal Antibody | anti-A2ML1 antibody

A2ML1 (Alpha-2-macroglobulin-like Protein 1, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 9, CPAMD9)

Gene Names
A2ML1; CPAMD9
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
A2ML1; Polyclonal Antibody; A2ML1 (Alpha-2-macroglobulin-like Protein 1; C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 9; CPAMD9); Anti -A2ML1 (Alpha-2-macroglobulin-like Protein 1; anti-A2ML1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human A2ML1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
Applicable Applications for anti-A2ML1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human A2ML1, aa1-158 (AAH93840.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of A2ML1 expression in transfected 293T cell line by A2ML1 polyclonal antibody. Lane1:A2ML1 transfected lysate (17.38kD). Lane2:Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of A2ML1 expression in transfected 293T cell line by A2ML1 polyclonal antibody. Lane1:A2ML1 transfected lysate (17.38kD). Lane2:Non-transfected lysate.)
Related Product Information for anti-A2ML1 antibody
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. Displays inhibitory activity against chymotrypsin, papain, thermolysin, subtilisin A and, to a lesser extent, elastase but not trypsin. May play an important role during desquamation by inhibiting extracellular proteases.
Product Categories/Family for anti-A2ML1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
161,107 Da
NCBI Official Full Name
alpha-2-macroglobulin-like protein 1 isoform 2
NCBI Official Synonym Full Names
alpha-2-macroglobulin-like 1
NCBI Official Symbol
A2ML1
NCBI Official Synonym Symbols
CPAMD9
NCBI Protein Information
alpha-2-macroglobulin-like protein 1; C3 and PZP-like, alpha-2-macroglobulin domain containing 9
UniProt Protein Name
Alpha-2-macroglobulin-like protein 1
UniProt Gene Name
A2ML1
UniProt Synonym Gene Names
CPAMD9
UniProt Entry Name
A2ML1_HUMAN

NCBI Description

This gene encodes a member of the alpha-macroglobulin superfamily. The encoded protein acts as an inhibitor for several proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus (PNP; PMID: 20805888). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]

Uniprot Description

A2ML1: Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. Displays inhibitory activity against chymotrypsin, papain, thermolysin, subtilisin A and, to a lesser extent, elastase but not trypsin. May play an important role during desquamation by inhibiting extracellular proteases. Belongs to the protease inhibitor I39 (alpha-2- macroglobulin) family.

Protein type: Secreted, signal peptide; Secreted; Inhibitor

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: extracellular space

Molecular Function: serine-type endopeptidase inhibitor activity; protease inhibitor activity

Biological Process: regulation of endopeptidase activity

Research Articles on A2ML1

Similar Products

Product Notes

The A2ML1 a2ml1 (Catalog #AAA6003127) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The A2ML1 (Alpha-2-macroglobulin-like Protein 1, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 9, CPAMD9) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's A2ML1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the A2ML1 a2ml1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYTLEASGQG CVYVQTVLRY NILPPTNMKT FSLSVEIGKA RCEQPTSPRS LTLTIHTSYV GSRSSSNMAI VEVKMLSGFS PMEGTNQLLL QQPLVKKVEF GTDTLNIYLD ELIKNTQTYT FTISQSVLVT NLKPATIKVY DYYLPDEQAT IQYSDPCE. It is sometimes possible for the material contained within the vial of "A2ML1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.