Western Blot (WB)
(WB Suggested Anti-2410015M20Rik AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Rabbit 2410015M20Rik Polyclonal Antibody | anti-2410015M20RIK antibody
2410015M20Rik Antibody - C-terminal region
Gene Names
Micos13; QIL1; Mic13; sr104; 2410015M20Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
2410015M20Rik; Polyclonal Antibody; 2410015M20Rik Antibody - C-terminal region; anti-2410015M20RIK antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGLEMPQLPTPPKIKFPNFRDSWNSGIISVMSALSVAPSKAREYSKEGWE
Sequence Length
119
Applicable Applications for anti-2410015M20RIK antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of 2410015M20Rik
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-2410015M20Rik AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Western Blot (WB)
(WB Suggested Anti-2410015M20Rik AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Related Product Information for anti-2410015M20RIK antibody
This is a rabbit polyclonal antibody against 2410015M20Rik. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-2410015M20RIK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
MICOS complex subunit MIC13
NCBI Official Synonym Full Names
mitochondrial contact site and cristae organizing system subunit 13
NCBI Official Symbol
Micos13
NCBI Official Synonym Symbols
QIL1; Mic13; sr104; 2410015M20Rik
NCBI Protein Information
MICOS complex subunit MIC13
UniProt Protein Name
MICOS complex subunit MIC13
UniProt Gene Name
Mic13
Uniprot Description
Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Constituent of mature MICOS complex, it is required for the formation of cristae junction (CJ) and maintenance of cristae morphology. Required for the incorporation of MINOS1/MIC10 into the MICOS complex.
Similar Products
Product Notes
The 2410015M20RIK mic13 (Catalog #AAA3211341) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The 2410015M20Rik Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's 2410015M20Rik can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the 2410015M20RIK mic13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGLEMPQLPT PPKIKFPNFR DSWNSGIISV MSALSVAPSK AREYSKEGWE. It is sometimes possible for the material contained within the vial of "2410015M20Rik, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
